StarFunc result for job id Q10469

User Input

>input (447 residues)
MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSV
AVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVL
VVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFS
IQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHF
VWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
YGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPK
FWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV
AISPPRKNGGWGDIRDHELCKSYRRLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q10469	1.000	1.000	8.627E-95	447	1.000	1.000	Q10469.pdb.gz	MGAT2_HUMAN Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=MGAT2 PE=1 SV=1
2	AFDB:Q09326	0.812	0.821	5.085E-84	442	0.890	0.900	Q09326.pdb.gz	MGAT2_RAT Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=Mgat2 PE=1 SV=1
3	PDB:5vcmB	0.771	0.959	8.671E-69	358	0.799	0.997	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
4	PDB:5vcsB	0.714	0.986	1.714E-65	323	0.718	0.994	5vcsB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
5	AFDB:Q59DT4	0.764	0.702	6.589E-47	488	0.369	0.338	Q59DT4.pdb.gz	Q59DT4_DROME Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat2 PE=3 SV=1
6	AFDB:A0A0B4KHE4	0.761	0.670	1.820E-46	509	0.369	0.324	A0A0B4KHE4.pdb.gz	A0A0B4KHE4_DROME Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat2 PE=3 SV=1
7	AFDB:O17560	0.760	0.699	2.669E-43	487	0.309	0.283	O17560.pdb.gz	O17560_CAEEL Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-20 PE=1 SV=2
8	AFDB:Q961U0	0.758	0.561	6.943E-43	608	0.378	0.278	Q961U0.pdb.gz	Q961U0_DROME Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat2 PE=2 SV=1
9	AFDB:Q9FT88	0.657	0.681	5.325E-29	430	0.244	0.253	Q9FT88.pdb.gz	MGAT2_ARATH Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Arabidopsis thaliana OX=3702 GN=GNT2 PE=1 SV=1
10	AFDB:Q5QM25	0.223	0.223	7.763E-7	446	0.145	0.146	Q5QM25.pdb.gz	IRX9L_ORYSJ Probable beta-1,4-xylosyltransferase IRX9L OS=Oryza sativa subsp. japonica OX=39947 GN=IRX9L PE=2 SV=1
11	AFDB:Q9FH90	0.231	0.211	1.792E-6	492	0.092	0.083	Q9FH90.pdb.gz	IX14H_ARATH Probable beta-1,4-xylosyltransferase IRX14H OS=Arabidopsis thaliana OX=3702 GN=IRX14H PE=2 SV=1
12	AFDB:Q8L707	0.223	0.192	7.084E-6	525	0.078	0.067	Q8L707.pdb.gz	IRX14_ARATH Beta-1,4-xylosyltransferase IRX14 OS=Arabidopsis thaliana OX=3702 GN=IRX14 PE=1 SV=1
13	PDB:5a07A	0.198	0.217	9.199E-5	395	0.065	0.073	5a07A.pdb.gz	Structure of the Glycosyltransferase Ktr4P from Saccharomyces Cerevisiae
14	PDB:7d72A	0.236	0.254	3.039E-4	407	0.063	0.069	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
15	PDB:7jhiC	0.261	0.332	1.526E-3	331	0.110	0.148	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
16	PDB:4d0tA	0.300	0.274	1.938E-3	496	0.081	0.073	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
17	PDB:4d11C	0.263	0.268	2.318E-3	436	0.087	0.089	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
18	PDB:8cvzI	0.268	0.411	2.944E-3	267	0.081	0.135	8cvzI.pdb.gz
19	PDB:4hg6A	0.282	0.181	3.523E-3	747	0.094	0.056	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
20	PDB:7au2A	0.224	0.159	4.214E-3	686	0.096	0.063	7au2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q09326	0.0	837	442	0.890	0.900	MGAT2_RAT Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=Mgat2 PE=1 SV=1
2	Q10469	0.0	936	447	1.000	1.000	MGAT2_HUMAN Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=MGAT2 PE=1 SV=1
3	Q921V5	0.0	833	442	0.886	0.896	MGAT2_MOUSE Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Mgat2 PE=1 SV=1
4	Q95UE9	3.15e-117	353	471	0.378	0.359	Q95UE9_DROME Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat2 PE=2 SV=1
5	Q59DT4	5.10e-117	353	488	0.378	0.346	Q59DT4_DROME Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat2 PE=3 SV=1
6	Q710C1	1.17e-116	351	471	0.378	0.359	Q710C1_DROME Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat2 PE=2 SV=1
7	A0A0B4KHE4	3.90e-112	341	509	0.378	0.332	A0A0B4KHE4_DROME Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat2 PE=3 SV=1
8	O17560	6.50e-100	309	487	0.356	0.326	O17560_CAEEL Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-20 PE=1 SV=2
9	Q961U0	9.42e-70	234	608	0.266	0.196	Q961U0_DROME Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat2 PE=2 SV=1
10	Q711U4	1.58e-69	233	591	0.266	0.201	Q711U4_DROME Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat2 PE=2 SV=1
11	Q9FT88	1.70e-51	181	430	0.242	0.251	MGAT2_ARATH Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Arabidopsis thaliana OX=3702 GN=GNT2 PE=1 SV=1
12	G3V275	0.005	38.5	96	0.045	0.208	G3V275_HUMAN Dishevelled associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=1
13	Q8BPM0	0.046	38.9	1077	0.043	0.018	DAAM1_MOUSE Disheveled-associated activator of morphogenesis 1 OS=Mus musculus OX=10090 GN=Daam1 PE=1 SV=4
14	Q9Y4D1	0.051	38.5	1078	0.043	0.018	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
15	A0A0R4IER9	0.092	37.7	1060	0.034	0.014	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
16	B3DJI0	1.8	33.5	1069	0.043	0.018	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
17	Q5RHJ3	1.8	33.5	1079	0.043	0.018	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
18	Q9R0T8	2.3	33.1	717	0.043	0.026	IKKE_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus OX=10090 GN=Ikbke PE=1 SV=2
19	Q38BI7	2.7	32.3	265	0.029	0.049	Q38BI7_TRYB2 NADH-ubiquinone oxidoreductase complex I subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3150 PE=3 SV=1
20	Q15154	7.1	31.6	2024	0.036	0.008	PCM1_HUMAN Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05060 MGAT2	2e-157	535.3	N-acetylglucosaminyltransferase II (MGAT2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307423

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353910	0.979	Alpha-(1,6)-fucosyltransferase
2	9606.ENSP00000261483	0.974	Alpha-mannosidase 2
3	9606.ENSP00000345270	0.970	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
4	9606.ENSP00000404718	0.970	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
5	9606.ENSP00000452948	0.961	Alpha-mannosidase 2x
6	9606.ENSP00000264968	0.958	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
7	9606.ENSP00000338487	0.954	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
8	9606.ENSP00000421185	0.953	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D
9	9606.ENSP00000481096	0.934	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C
10	9606.ENSP00000386377	0.872	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
11	9606.ENSP00000417764	0.753	Alpha-1,3/1,6-mannosyltransferase ALG2
12	9606.ENSP00000362282	0.729	Molybdenum cofactor biosynthesis protein 1
13	9606.ENSP00000389175	0.707	Glycerate kinase
14	9606.ENSP00000369055	0.664	Beta-1,4-galactosyltransferase 1
15	9606.ENSP00000400995	0.650	Biotinidase
16	9606.ENSP00000302728	0.645	Beta-glucuronidase
17	9606.ENSP00000380157	0.641	Molybdopterin synthase catalytic subunit
18	9606.ENSP00000319531	0.630	Glycine cleavage system H protein, mitochondrial
19	9606.ENSP00000215838	0.618	Transcobalamin-2
20	9606.ENSP00000247933	0.609	Alpha-L-iduronidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140103	1.000	catalytic activity, acting on a glycoprotein
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0005488	0.998	binding
GO:0005515	0.988	protein binding
GO:0008455	0.982	alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0043167	0.794	ion binding
GO:0046872	0.767	metal ion binding
GO:0030145	0.754	manganese ion binding
GO:0046983	0.716	protein dimerization activity
GO:0042802	0.711	identical protein binding
GO:0042803	0.678	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0019538	0.992	protein metabolic process
GO:0044249	0.991	cellular biosynthetic process
GO:1901566	0.987	organonitrogen compound biosynthetic process
GO:1901135	0.985	carbohydrate derivative metabolic process
GO:0044260	0.979	cellular macromolecule metabolic process
GO:1901137	0.967	carbohydrate derivative biosynthetic process
GO:0009059	0.963	macromolecule biosynthetic process
GO:0009100	0.950	glycoprotein metabolic process
GO:0006486	0.939	protein glycosylation
GO:0006487	0.920	protein N-linked glycosylation
GO:0019080	0.513	viral gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.995	Golgi membrane
GO:0031984	0.647	organelle subcompartment
GO:0098791	0.444	Golgi apparatus subcompartment
GO:0005795	0.422	Golgi stack
GO:0031985	0.366	Golgi cisterna
GO:0070013	0.337	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:12941	0.982	N(4)-{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP
EC:2.4.1.143	0.982	alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.

[back to server]