StarFunc result for job id Q10570

User Input

>input (1443 residues)
MYAVYKQAHPPTGLEFSMYCNFFNNSERNLVVAGTSQLYVYRLNRDAEALTKNDRSTEGK
AHREKLELAASFSFFGNVMSMASVQLAGAKRDALLLSFKDAKLSVVEYDPGTHDLKTLSL
HYFEEPELRDGFVQNVHTPRVRVDPDGRCAAMLVYGTRLVVLPFRRESLAEEHEGLVGEG
QRSSFLPSYIIDVRALDEKLLNIIDLQFLHGYYEPTLLILFEPNQTWPGRVAVRQDTCSI
VAISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVAL
NSLTTGTTAFPLRTQEGVRITLDCAQATFISYDKMVISLKGGEIYVLTLITDGMRSVRAF
HFDKAAASVLTTSMVTMEPGYLFLGSRLGNSLLLKYTEKLQEPPASAVREAADKEEPPSK
KKRVDATAGWSAAGKSVPQDEVDEIEVYGSEAQSGTQLATYSFEVCDSILNIGPCANAAV
GEPAFLSEEFQNSPEPDLEIVVCSGHGKNGALSVLQKSIRPQVVTTFELPGCYDMWTVIA
PVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSREDSTMILQTGQEIMELDTSGF
ATQGPTVFAGNIGDNRYIVQVSPLGIRLLEGVNQLHFIPVDLGAPIVQCAVADPYVVIMS
AEGHVTMFLLKSDSYGGRHHRLALHKPPLHHQSKVITLCLYRDLSGMFTTESRLGGARDE
LGGRSGPEAEGLGSETSPTVDDEEEMLYGDSGSLFSPSKEEARRSSQPPADRDPAPFRAE
PTHWCLLVRENGTMEIYQLPDWRLVFLVKNFPVGQRVLVDSSFGQPTTQGEARREEATRQ
GELPLVKEVLLVALGSRQSRPYLLVHVDQELLIYEAFPHDSQLGQGNLKVRFKKVPHNIN
FREKKPKPSKKKAEGGGAEEGAGARGRVARFRYFEDIYGYSGVFICGPSPHWLLVTGRGA
LRLHPMAIDGPVDSFAPFHNVNCPRGFLYFNRQGELRISVLPAYLSYDAPWPVRKIPLRC
TAHYVAYHVESKVYAVATSTNTPCARIPRMTGEEKEFETIERDERYIHPQQEAFSIQLIS
PVSWEAIPNARIELQEWEHVTCMKTVSLRSEETVSGLKGYVAAGTCLMQGEEVTCRGRIL
IMDVIEVVPEPGQPLTKNKFKVLYEKEQKGPVTALCHCNGHLVSAIGQKIFLWSLRASEL
TGMAFIDTQLYIHQMISVKNFILAADVMKSISLLRYQEESKTLSLVSRDAKPLEVYSVDF
MVDNAQLGFLVSDRDRNLMVYMYLPEAKESFGGMRLLRRADFHVGAHVNTFWRTPCRGAT
EGLSKKSVVWENKHITWFATLDGGIGLLLPMQEKTYRRLLMLQNALTTMLPHHAGLNPRA
FRMLHVDRRTLQNAVRNVLDGELLNRYLYLSTMERSELAKKIGTTPDIILDDLLETDRVT
AHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6urgA	0.827	0.991	0.000	1202	0.831	0.998	6urgA.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.
2	AFDB:A0A0R4IC37	0.942	0.937	0.000	1451	0.798	0.794	A0A0R4IC37.pdb.gz	CPSF1_DANRE Cleavage and polyadenylation specificity factor subunit 1 OS=Danio rerio OX=7955 GN=cpsf1 PE=3 SV=2
3	AFDB:O74733	0.821	0.822	0.000	1441	0.248	0.248	O74733.pdb.gz	CFT1_SCHPO Protein cft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cft1 PE=3 SV=1
4	AFDB:Q10570	1.000	1.000	0.000	1443	1.000	1.000	Q10570.pdb.gz	CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens OX=9606 GN=CPSF1 PE=1 SV=2
5	AFDB:Q9FGR0	0.814	0.815	0.000	1442	0.326	0.326	Q9FGR0.pdb.gz	CPSF1_ARATH Cleavage and polyadenylation specificity factor subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CPSF160 PE=1 SV=2
6	AFDB:Q9V726	0.871	0.864	0.000	1455	0.468	0.464	Q9V726.pdb.gz	CPSF1_DROME Cleavage and polyadenylation specificity factor subunit 1 OS=Drosophila melanogaster OX=7227 GN=Cpsf160 PE=1 SV=1
7	AFDB:Q06632	0.750	0.795	7.942E-89	1357	0.204	0.217	Q06632.pdb.gz	CFT1_YEAST Protein CFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CFT1 PE=1 SV=1
8	AFDB:Q381Y1	0.726	0.722	1.140E-81	1452	0.199	0.198	Q381Y1.pdb.gz	Q381Y1_TRYB2 Cleavage and polyadenylation specificity factor-like protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6170 PE=4 SV=1
9	PDB:7zgrA	0.747	0.854	1.269E-78	1254	0.200	0.230	7zgrA.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
10	AFDB:Q6L4S0	0.566	0.728	9.947E-73	1090	0.177	0.235	Q6L4S0.pdb.gz	DDB1_ORYSJ DNA damage-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=DBB1 PE=1 SV=1
11	AFDB:O49552	0.570	0.734	8.057E-71	1088	0.181	0.240	O49552.pdb.gz	DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana OX=3702 GN=DDB1B PE=1 SV=2
12	AFDB:B0M0P5	0.559	0.667	1.299E-70	1181	0.163	0.199	B0M0P5.pdb.gz	DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum OX=44689 GN=repE PE=1 SV=1
13	PDB:6xk9Y	0.520	0.666	4.821E-68	1106	0.164	0.213	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.
14	PDB:2hyeA	0.512	0.639	6.996E-67	1140	0.164	0.207	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
15	PDB:5hxbY	0.510	0.668	4.728E-66	1080	0.161	0.215	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
16	PDB:7dvq3	0.582	0.689	1.605E-63	1193	0.162	0.196	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:7uknA	0.613	0.820	2.847E-63	1059	0.162	0.221	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
18	PDB:3e0cA	0.595	0.829	5.051E-63	1011	0.161	0.229	3e0cA.pdb.gz
19	PDB:5o9zw	0.531	0.654	3.190E-60	1140	0.150	0.190	5o9zw.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
20	PDB:5nrlP	0.526	0.625	3.366E-46	1186	0.135	0.164	5nrlP.pdb.gz	Structure of a pre-catalytic spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IC37	0.0	2394	1451	0.799	0.795	CPSF1_DANRE Cleavage and polyadenylation specificity factor subunit 1 OS=Danio rerio OX=7955 GN=cpsf1 PE=3 SV=2
2	Q10570	0.0	2991	1443	1.000	1.000	CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens OX=9606 GN=CPSF1 PE=1 SV=2
3	Q9V726	0.0	1269	1455	0.471	0.467	CPSF1_DROME Cleavage and polyadenylation specificity factor subunit 1 OS=Drosophila melanogaster OX=7227 GN=Cpsf160 PE=1 SV=1
4	O74733	1.16e-145	484	1441	0.270	0.271	CFT1_SCHPO Protein cft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cft1 PE=3 SV=1
5	Q9FGR0	6.39e-97	345	1442	0.154	0.154	CPSF1_ARATH Cleavage and polyadenylation specificity factor subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CPSF160 PE=1 SV=2
6	Q06632	1.44e-40	166	1357	0.099	0.105	CFT1_YEAST Protein CFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CFT1 PE=1 SV=1
7	Q381Y1	7.09e-33	141	1452	0.106	0.105	Q381Y1_TRYB2 Cleavage and polyadenylation specificity factor-like protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6170 PE=4 SV=1
8	Q6L4S0	5.55e-21	102	1090	0.080	0.106	DDB1_ORYSJ DNA damage-binding protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=DBB1 PE=1 SV=1
9	Q9M0V3	3.74e-19	96.7	1088	0.079	0.105	DDB1A_ARATH DNA damage-binding protein 1a OS=Arabidopsis thaliana OX=3702 GN=DDB1A PE=1 SV=1
10	O49552	3.43e-18	93.6	1088	0.076	0.100	DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana OX=3702 GN=DDB1B PE=1 SV=2
11	A1A4K3	2.17e-15	84.3	1140	0.055	0.069	DDB1_BOVIN DNA damage-binding protein 1 OS=Bos taurus OX=9913 GN=DDB1 PE=1 SV=1
12	Q16531	2.47e-15	84.3	1140	0.055	0.069	DDB1_HUMAN DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1
13	Q3U1J4	2.55e-15	84.3	1140	0.055	0.069	DDB1_MOUSE DNA damage-binding protein 1 OS=Mus musculus OX=10090 GN=Ddb1 PE=1 SV=2
14	Q805F9	1.78e-14	81.6	1140	0.056	0.071	DDB1_CHICK DNA damage-binding protein 1 OS=Gallus gallus OX=9031 GN=DDB1 PE=1 SV=1
15	Q9ESW0	1.97e-14	81.3	1140	0.054	0.068	DDB1_RAT DNA damage-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ddb1 PE=1 SV=1
16	Q6PGT6	8.80e-14	79.0	897	0.085	0.137	Q6PGT6_DANRE DNA damage-binding protein 1 OS=Danio rerio OX=7955 GN=zgc:63840 PE=1 SV=1
17	Q15393	1.40e-11	72.0	1217	0.096	0.113	SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4
18	Q9W0M7	2.23e-11	71.2	1227	0.096	0.113	SF3B3_DROME Splicing factor 3B subunit 3 OS=Drosophila melanogaster OX=7227 GN=Sf3b3 PE=1 SV=2
19	B0M0P5	3.42e-10	67.4	1181	0.042	0.052	DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum OX=44689 GN=repE PE=1 SV=1
20	Q9XYZ5	1.51e-09	65.5	1140	0.045	0.057	DDB1_DROME DNA damage-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=pic PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03178 CPSF_A	3.6e-87	304.3	CPSF A subunit region
2	PF10433 MMS1_N	2.9e-35	133.5	Mono-functional DNA-alkylating methyl methanesulfonate N-term
3	PF10625 UspB	2e+02	13.3	Universal stress protein B (UspB)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484669

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216277	0.999	Poly(A) polymerase alpha
2	9606.ENSP00000238112	0.999	Cleavage and polyadenylation specificity factor subunit 3
3	9606.ENSP00000245934	0.999	Symplekin
4	9606.ENSP00000292476	0.999	Cleavage and polyadenylation specificity factor subunit 4
5	9606.ENSP00000298875	0.999	Cleavage and polyadenylation specificity factor subunit 2
6	9606.ENSP00000315791	0.999	Cleavage stimulation factor subunit 3
7	9606.ENSP00000325377	0.999	pre-mRNA 3' end processing protein WDR33
8	9606.ENSP00000336752	0.999	Pre-mRNA 3'-end-processing factor FIP1
9	9606.ENSP00000362063	0.998	Cleavage stimulation factor subunit 2
10	9606.ENSP00000291386	0.994	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
11	9606.ENSP00000317872	0.992	E3 ubiquitin-protein ligase RBBP6
12	9606.ENSP00000217109	0.989	Cleavage stimulation factor subunit 1
13	9606.ENSP00000296490	0.987	WD repeat-containing protein 82
14	9606.ENSP00000300291	0.987	Cleavage and polyadenylation specificity factor subunit 5
15	9606.ENSP00000231498	0.981	Nuclear pore complex protein Nup155
16	9606.ENSP00000266679	0.980	Cleavage and polyadenylation specificity factor subunit 6
17	9606.ENSP00000263956	0.976	General transcription factor 3C polypeptide 3
18	9606.ENSP00000332444	0.976	Cleavage stimulation factor subunit 2 tau variant
19	9606.ENSP00000434995	0.976	Polyribonucleotide 5'-hydroxyl-kinase Clp1
20	9606.ENSP00000345412	0.974	Cleavage and polyadenylation specificity factor subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0035925	1.000	mRNA 3'-UTR AU-rich region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0043631	0.975	RNA polyadenylation
GO:0006378	0.965	mRNA polyadenylation
GO:0090305	0.913	nucleic acid phosphodiester bond hydrolysis
GO:0090501	0.827	RNA phosphodiester bond hydrolysis
GO:0050789	0.656	regulation of biological process
GO:0050794	0.448	regulation of cellular process
GO:0019222	0.307	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.999	nuclear protein-containing complex
GO:0005849	0.985	mRNA cleavage factor complex
GO:0005847	0.983	mRNA cleavage and polyadenylation specificity factor complex
GO:0005737	0.704	cytoplasm
GO:1902494	0.626	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]