StarFunc result for job id Q10571

User Input

>input (1320 residues)
MFGLDQFEPQVNSRNAGQGERNFNETGLSMNTHFKAPAFHTGGPPGPVDPAMSALGEPPI
LGMNMEPYGFHARGHSELHAGGLQAQPVHGFFGGQQPHHGHPGSHHPHQHHPHFGGNFGG
PDPGASCLHGGRLLGYGGAAGGLGSQPPFAEGYEHMAESQGPESFGPQRPGNLPDFHSSG
ASSHAVPAPCLPLDQSPNRAASFHGLPSSSGSDSHSLEPRRVTNQGAVDSLEYNYPGEAP
SGHFDMFSPSDSEGQLPHYAAGRQVPGGAFPGASAMPRAAGMVGLSKMHAQPPQQQPQQQ
QQPQQQQQQHGVFFERFSGARKMPVGLEPSVGSRHPLMQPPQQAPPPPQQQPPQQPPQQQ
PPPPPGLLVRQNSCPPALPRPQQGEAGTPSGGLQDGGPMLPSQHAQFEYPIHRLENRSMH
PYSEPVFSMQHPPPQQAPNQRLQHFDAPPYMNVAKRPRFDFPGSAGVDRCASWNGSMHNG
ALDNHLSPSAYPGLPGEFTPPVPDSFPSGPPLQHPAPDHQSLQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQRQNAALMIKQMASRNQQQRLRQPNLAQLGHPGDVGQGGLVHGGPVGGLAQ
PNFEREGGSTGAGRLGTFEQQAPHLAQESAWFSGPHPPPGDLLPRRMGGSGLPADCGPHD
PSLAPPPPPGGSGVLFRGPLQEPMRMPGEGHVPALPSPGLQFGGSLGGLGQLQSPGAGVG
LPSAASERRPPPPDFATSALGGQPGFPFGAAGRQSTPHSGPGVNSPPSAGGGGGSSGGGG
GGGAYPPQPDFQPSQRTSASKLGALSLGSFNKPSSKDNLFGQSCLAALSTACQNMIASLG
APNLNVTFNKKNPPEGKRKLSQNETDGAAVAGNPGSDYFPGGTAPGAPGPGGPSGTSSSG
SKASGPPNPPAQGDGTSLSPNYTLESTSGNDGKPVSGGGGRGRGRRKRDSGHVSPGTFFD
KYSAAPDSGGAPGVSPGQQQASGAAVGGSSAGETRGAPTPHEKALTSPSWGKGAELLLGD
QPDLIGSLDGGAKSDSSSPNVGEFASDEVSTSYANEDEVSSSSDNPQALVKASRSPLVTG
SPKLPPRGVGAGEHGPKAPPPALGLGIMSNSTSTPDSYGGGGGPGHPGTPGLEQVRTPTS
SSGAPPPDEIHPLEILQAQIQLQRQQFSISEDQPLGLKGGKKGECAVGASGAQNGDSELG
SCCSEAVKSAMSTIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKE
AHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3YWE6	0.120	0.122	0.000	1297	0.897	0.913	D3YWE6.pdb.gz	MN1_MOUSE Transcriptional activator MN1 OS=Mus musculus OX=10090 GN=Mn1 PE=2 SV=1
2	AFDB:Q10571	0.999	0.999	0.000	1320	1.000	1.000	Q10571.pdb.gz	MN1_HUMAN Transcriptional activator MN1 OS=Homo sapiens OX=9606 GN=MN1 PE=1 SV=3
3	AFDB:Q9Y3S1	0.043	0.029	1.077E-4	2297	0.189	0.108	Q9Y3S1.pdb.gz	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
4	AFDB:Q1W617	0.055	0.051	3.493E-4	1475	0.139	0.125	Q1W617.pdb.gz	SHRM4_MOUSE Protein Shroom4 OS=Mus musculus OX=10090 GN=Shroom4 PE=1 SV=1
5	AFDB:Q9VMD0	0.046	0.038	4.494E-4	1659	0.145	0.115	Q9VMD0.pdb.gz	DAXX_DROME Daxx-like protein OS=Drosophila melanogaster OX=7227 GN=Daxx PE=1 SV=3
6	AFDB:F1Q6T6	0.034	0.027	4.888E-4	2357	0.178	0.100	F1Q6T6.pdb.gz
7	AFDB:Q9P266	0.040	0.039	5.317E-4	1359	0.164	0.159	Q9P266.pdb.gz	JCAD_HUMAN Junctional cadherin 5-associated protein OS=Homo sapiens OX=9606 GN=JCAD PE=1 SV=3
8	AFDB:Q5DTX6	0.039	0.039	6.290E-4	1320	0.161	0.161	Q5DTX6.pdb.gz	JCAD_MOUSE Junctional cadherin 5-associated protein OS=Mus musculus OX=10090 GN=Jcad PE=1 SV=2
9	AFDB:Q8NEY1	0.032	0.028	9.574E-4	1877	0.142	0.100	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
10	AFDB:Q9VCH1	0.034	0.026	1.041E-3	2072	0.159	0.101	Q9VCH1.pdb.gz	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
11	PDB:2ndjA	0.021	0.223	7.944	103	0.006	0.078	2ndjA.pdb.gz
12	PDB:5xteA	0.024	0.243	9.398	81	0.005	0.086	5xteA.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YWE6	0.0	1898	1297	0.892	0.908	MN1_MOUSE Transcriptional activator MN1 OS=Mus musculus OX=10090 GN=Mn1 PE=2 SV=1
2	Q10571	0.0	2592	1320	1.000	1.000	MN1_HUMAN Transcriptional activator MN1 OS=Homo sapiens OX=9606 GN=MN1 PE=1 SV=3
3	Q59E49	6.8	33.5	1203	0.023	0.025	Q59E49_DROME Histone deacetylase OS=Drosophila melanogaster OX=7227 GN=HDAC4 PE=1 SV=2
4	Q8I9J7	9.6	33.1	1203	0.023	0.025	Q8I9J7_DROME Histone deacetylase OS=Drosophila melanogaster OX=7227 GN=HDAC4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304956

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306884	0.944	C-X-C motif chemokine 11
2	9606.ENSP00000312457	0.807	Brain and acute leukemia, cytoplasmic
3	9606.ENSP00000281938	0.774	Heat shock protein beta-8
4	9606.ENSP00000256103	0.730	Myelin P2 protein
5	9606.ENSP00000249842	0.689	Immunoglobulin superfamily containing leucine rich repeat
6	9606.ENSP00000258873	0.653	Long-chain-fatty-acid--CoA ligase ACSBG1
7	9606.ENSP00000348429	0.646	Long-chain-fatty-acid--CoA ligase 5
8	9606.ENSP00000368566	0.644	Long-chain-fatty-acid--CoA ligase 6
9	9606.ENSP00000255078	0.642	DNA-binding protein SMUBP-2
10	9606.ENSP00000354791	0.641	Dynactin subunit 1
11	9606.ENSP00000363683	0.630	Myelodysplastic syndrome 2 translocation associated
12	9606.ENSP00000373918	0.630	Glycine--tRNA ligase
13	9606.ENSP00000303394	0.628	Heat shock protein beta-3
14	9606.ENSP00000291232	0.619	Tumor necrosis factor receptor superfamily member 13C
15	9606.ENSP00000479860	0.606	Calcium and integrin binding 1
16	9606.ENSP00000427329	0.601	Forkhead box R2
17	9606.ENSP00000296930	0.600	Nucleophosmin
18	9606.ENSP00000406191	0.578	Transient receptor potential cation channel subfamily V member 4
19	9606.ENSP00000359295	0.571	Protein Dr1
20	9606.ENSP00000233121	0.570	Microtubule-associated protein RP/EB family member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.981	regulation of cellular process
GO:0048583	0.905	regulation of response to stimulus
GO:0048522	0.886	positive regulation of cellular process
GO:0048523	0.868	negative regulation of cellular process
GO:0051726	0.816	regulation of cell cycle
GO:0032501	0.744	multicellular organismal process
GO:0009987	0.724	cellular process
GO:0010646	0.699	regulation of cell communication
GO:1901987	0.653	regulation of cell cycle phase transition
GO:1902806	0.619	regulation of cell cycle G1/S phase transition
GO:0023051	0.610	regulation of signaling
GO:0001503	0.571	ossification
GO:0032104	0.548	regulation of response to extracellular stimulus
GO:0019222	0.522	regulation of metabolic process
GO:0031323	0.507	regulation of cellular metabolic process
GO:0060255	0.495	regulation of macromolecule metabolic process
GO:0051171	0.445	regulation of nitrogen compound metabolic process
GO:0042127	0.409	regulation of cell population proliferation
GO:0080090	0.389	regulation of primary metabolic process
GO:0009966	0.358	regulation of signal transduction
GO:0019219	0.346	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.338	regulation of biosynthetic process
GO:0051252	0.337	regulation of RNA metabolic process
GO:0009893	0.332	positive regulation of metabolic process
GO:0010556	0.313	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.916	intracellular organelle lumen
GO:0031981	0.898	nuclear lumen
GO:0005654	0.789	nucleoplasm
GO:0005737	0.753	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]