StarFunc result for job id Q10588

User Input

>input (318 residues)
MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSP
EQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFA
DNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYS
KDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGE
GSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQ
RAGLIIPLFLVLASRTQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q10588	1.000	1.000	7.397E-66	318	1.000	1.000	Q10588.pdb.gz	BST1_HUMAN ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 OS=Homo sapiens OX=9606 GN=BST1 PE=1 SV=2
2	PDB:1isgA	0.785	0.999	1.031E-51	250	0.774	0.984	1isgA.pdb.gz	Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
3	AFDB:P56528	0.758	0.791	3.056E-31	304	0.318	0.332	P56528.pdb.gz	CD38_MOUSE ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Mus musculus OX=10090 GN=Cd38 PE=1 SV=2
4	AFDB:Q64244	0.757	0.793	1.220E-30	303	0.305	0.320	Q64244.pdb.gz	CD38_RAT ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Cd38 PE=1 SV=1
5	AFDB:P28907	0.737	0.778	1.035E-27	300	0.308	0.327	P28907.pdb.gz	CD38_HUMAN ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Homo sapiens OX=9606 GN=CD38 PE=1 SV=2
6	AFDB:Q9MZ03	0.746	0.794	3.449E-27	298	0.280	0.299	Q9MZ03.pdb.gz	CD38_RABIT ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Oryctolagus cuniculus OX=9986 GN=CD38 PE=1 SV=1
7	AFDB:F4KGG4	0.255	0.348	3.066E-3	213	0.063	0.094	F4KGG4.pdb.gz	F4KGG4_ARATH RAB GTPase homolog H1A OS=Arabidopsis thaliana OX=3702 GN=RABH1A PE=1 SV=1
8	AFDB:P36017	0.236	0.330	3.458E-3	210	0.094	0.143	P36017.pdb.gz	VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS21 PE=1 SV=1
9	AFDB:Q9NGC3	0.262	0.105	6.706E-3	995	0.110	0.035	Q9NGC3.pdb.gz	CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2
10	AFDB:D6XLG8	0.244	0.333	7.564E-3	216	0.079	0.116	D6XLG8.pdb.gz	D6XLG8_TRYB2 Small GTP-binding protein Rab11 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.590 PE=4 SV=1
11	AFDB:P0CY31	0.256	0.359	8.033E-3	210	0.066	0.100	P0CY31.pdb.gz	SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC4 PE=1 SV=1
12	PDB:5szhB	0.242	0.389	9.619E-3	175	0.063	0.114	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
13	PDB:1ukvY	0.231	0.333	1.152E-2	197	0.072	0.117	1ukvY.pdb.gz	Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
14	PDB:6lss4	0.264	0.158	1.557E-2	620	0.110	0.056	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
15	PDB:6n8jb	0.258	0.150	2.373E-2	647	0.085	0.042	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
16	PDB:4d02A	0.212	0.179	2.520E-2	399	0.091	0.073	4d02A.pdb.gz	Structure of Escherichia Coli Flavodiiron Nitric Oxide Reductase.
17	PDB:5sziA	0.226	0.354	4.079E-2	174	0.085	0.155	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
18	PDB:5ub8A	0.247	0.390	4.887E-2	174	0.057	0.103	5ub8A.pdb.gz	Crystal structure of YPT31, a Rab family GTPase from Candida albicans, in complex with GDP and Zn(II)
19	PDB:6ylgb	0.253	0.149	4.887E-2	613	0.085	0.044	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
20	PDB:2wkpA	0.212	0.211	5.190E-2	320	0.063	0.062	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q10588	0.0	661	318	1.000	1.000	BST1_HUMAN ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 OS=Homo sapiens OX=9606 GN=BST1 PE=1 SV=2
2	P56528	2.98e-60	196	304	0.340	0.355	CD38_MOUSE ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Mus musculus OX=10090 GN=Cd38 PE=1 SV=2
3	Q64244	1.26e-57	189	303	0.296	0.310	CD38_RAT ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Cd38 PE=1 SV=1
4	P28907	9.37e-54	179	300	0.292	0.310	CD38_HUMAN ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Homo sapiens OX=9606 GN=CD38 PE=1 SV=2
5	Q9MZ03	2.25e-53	178	298	0.292	0.312	CD38_RABIT ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 OS=Oryctolagus cuniculus OX=9986 GN=CD38 PE=1 SV=1
6	Q21ML9	3.9	32.0	3474	0.066	0.006	Q21ML9_SACD2 Cadherin domain-containing protein OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=Sde_0798 PE=1 SV=1
7	B5TRE1	7.5	30.8	925	0.060	0.021	B5TRE1_CAEEL ERI-6/7 OS=Caenorhabditis elegans OX=6239 GN=eri-6/7 PE=2 SV=1
8	Q74JM7	10.0	30.4	589	0.082	0.044	Q74JM7_LACJO Pyruvate kinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) OX=257314 GN=LJ_1080 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02267 Rib_hydrolayse	6.3e-100	345.0	ADP-ribosyl cyclase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265016

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222553	0.956	Nicotinamide phosphoribosyltransferase
2	9606.ENSP00000340523	0.949	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
3	9606.ENSP00000366410	0.949	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
4	9606.ENSP00000287713	0.942	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
5	9606.ENSP00000354238	0.929	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
6	9606.ENSP00000441434	0.927	Nicotinamide N-methyltransferase
7	9606.ENSP00000406261	0.920	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
8	9606.ENSP00000354532	0.919	Purine nucleoside phosphorylase
9	9606.ENSP00000226279	0.913	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
10	9606.ENSP00000326424	0.912	Glutamine-dependent NAD(+) synthetase
11	9606.ENSP00000230792	0.904	Peroxisomal NADH pyrophosphatase NUDT12
12	9606.ENSP00000371362	0.902	NAD kinase 2, mitochondrial
13	9606.ENSP00000264663	0.901	NAD(P) transhydrogenase, mitochondrial
14	9606.ENSP00000202967	0.837	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
15	9606.ENSP00000329466	0.837	NAD-dependent protein deacetylase sirtuin-7
16	9606.ENSP00000476228	0.837	NAD-dependent protein deacylase sirtuin-5, mitochondrial
17	9606.ENSP00000337332	0.824	NAD-dependent protein deacetylase sirtuin-6
18	9606.ENSP00000372191	0.824	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
19	9606.ENSP00000249396	0.823	NAD-dependent protein deacetylase sirtuin-2
20	9606.ENSP00000212015	0.804	NAD-dependent protein deacetylase sirtuin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0009975	1.000	cyclase activity
GO:0016799	1.000	hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0061811	0.852	ADP-ribosyl cyclase activity
GO:0061812	0.852	cyclic ADP-ribose hydrolase
GO:0005488	0.423	binding
GO:0005515	0.408	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.972	response to stimulus
GO:0048522	0.961	positive regulation of cellular process
GO:0023052	0.953	signaling
GO:0007154	0.953	cell communication
GO:0042127	0.951	regulation of cell population proliferation
GO:0051716	0.944	cellular response to stimulus
GO:0019222	0.939	regulation of metabolic process
GO:0002682	0.935	regulation of immune system process
GO:0007165	0.929	signal transduction
GO:0031323	0.921	regulation of cellular metabolic process
GO:0051171	0.915	regulation of nitrogen compound metabolic process
GO:0080090	0.910	regulation of primary metabolic process
GO:0060255	0.905	regulation of macromolecule metabolic process
GO:0048583	0.859	regulation of response to stimulus
GO:0051246	0.684	regulation of protein metabolic process
GO:0080134	0.682	regulation of response to stress
GO:0008152	0.605	metabolic process
GO:0006807	0.545	nitrogen compound metabolic process
GO:0071704	0.500	organic substance metabolic process
GO:0008284	0.472	positive regulation of cell population proliferation
GO:0002376	0.459	immune system process
GO:0032101	0.428	regulation of response to external stimulus
GO:1901564	0.395	organonitrogen compound metabolic process
GO:0044237	0.386	cellular metabolic process
GO:0048519	0.375	negative regulation of biological process
GO:0023051	0.373	regulation of signaling
GO:0010646	0.371	regulation of cell communication
GO:0048523	0.360	negative regulation of cellular process
GO:0044238	0.359	primary metabolic process
GO:0019220	0.355	regulation of phosphate metabolic process
GO:0031399	0.355	regulation of protein modification process
GO:0040012	0.349	regulation of locomotion
GO:0051128	0.338	regulation of cellular component organization
GO:2000145	0.338	regulation of cell motility
GO:0009966	0.336	regulation of signal transduction
GO:0030155	0.333	regulation of cell adhesion
GO:0042325	0.333	regulation of phosphorylation
GO:0009893	0.324	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0070062	0.997	extracellular exosome
GO:0031090	0.992	organelle membrane
GO:0098588	0.976	bounding membrane of organelle
GO:0031410	0.973	cytoplasmic vesicle
GO:0099503	0.941	secretory vesicle
GO:0030141	0.934	secretory granule
GO:0030659	0.914	cytoplasmic vesicle membrane
GO:0030667	0.839	secretory granule membrane
GO:0031254	0.803	cell trailing edge
GO:0042995	0.705	cell projection
GO:0019898	0.697	extrinsic component of membrane
GO:0120025	0.667	plasma membrane bounded cell projection
GO:0042581	0.635	specific granule
GO:0035579	0.587	specific granule membrane
GO:0070013	0.567	intracellular organelle lumen
GO:0001931	0.464	uropod

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	1.000	Hydrolyzing N-glycosyl compounds.

[back to server]