StarFunc result for job id Q10713

User Input

>input (525 residues)
MAAVVLAATRLLRGSGSWGCSRLRFGPPAYRRFSSGGAYPNIPLSSPLPGVPKPVFATVD
GQEKFETKVTTLDNGLRVASQNKFGQFCTVGILINSGSRYEAKYLSGIAHFLEKLAFSST
ARFDSKDEILLTLEKHGGICDCQTSRDTTMYAVSADSKGLDTVVALLADVVLQPRLTDEE
VEMTRMAVQFELEDLNLRPDPEPLLTEMIHEAAYRENTVGLHRFCPTENVAKINREVLHS
YLRNYYTPDRMVLAGVGVEHEHLVDCARKYLLGVQPAWGSAEAVDIDRSVAQYTGGIAKL
ERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSFSAGGPGKGMF
SRLYLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQVREMVEIITKEFILMGGTVD
TVELERAKTQLTSMLMMNLESRPVIFEDVGRQVLATRSRKLPHELCTLIRNVKPEDVKRV
ASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLPRTYRLFR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q10713	1.000	1.000	0.000	525	1.000	1.000	Q10713.pdb.gz	MPPA_HUMAN Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2
2	AFDB:P20069	0.931	0.933	3.237E-86	524	0.857	0.859	P20069.pdb.gz	MPPA_RAT Mitochondrial-processing peptidase subunit alpha OS=Rattus norvegicus OX=10116 GN=Pmpca PE=1 SV=1
3	AFDB:Q95XN2	0.875	0.894	9.210E-56	514	0.375	0.383	Q95XN2.pdb.gz	MPPA_CAEEL Mitochondrial-processing peptidase subunit alpha OS=Caenorhabditis elegans OX=6239 GN=mppa-1 PE=3 SV=2
4	AFDB:P11914	0.793	0.861	1.512E-45	482	0.301	0.328	P11914.pdb.gz	MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAS2 PE=1 SV=1
5	PDB:1hr6A	0.786	0.898	2.112E-44	457	0.297	0.341	1hr6A.pdb.gz	Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences.
6	AFDB:Q9ZU25	0.836	0.871	2.651E-44	503	0.299	0.312	Q9ZU25.pdb.gz	MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPalpha1 PE=1 SV=1
7	AFDB:O04308	0.828	0.870	1.173E-43	499	0.286	0.301	O04308.pdb.gz	MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPalpha2 PE=1 SV=1
8	AFDB:A0A1D8PN84	0.807	0.812	2.680E-43	522	0.286	0.287	A0A1D8PN84.pdb.gz	A0A1D8PN84_CANAL Mitochondrial-processing protease subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAS2 PE=4 SV=1
9	AFDB:O94745	0.790	0.824	9.005E-43	502	0.288	0.301	O94745.pdb.gz	MPPA_SCHPO Probable mitochondrial-processing peptidase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mas2 PE=3 SV=2
10	AFDB:Q9VFF0	0.766	0.853	3.059E-41	470	0.261	0.291	Q9VFF0.pdb.gz	Q9VFF0_DROME GH01077p OS=Drosophila melanogaster OX=7227 GN=UQCR-C1 PE=1 SV=2
11	AFDB:Q03346	0.765	0.820	5.925E-41	489	0.278	0.299	Q03346.pdb.gz	MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus OX=10116 GN=Pmpcb PE=1 SV=3
12	PDB:7o37A	0.764	0.894	1.732E-37	446	0.248	0.291	7o37A.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
13	PDB:1hr6D	0.755	0.890	7.664E-37	443	0.234	0.278	1hr6D.pdb.gz	Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences.
14	PDB:5xteY	0.758	0.886	7.834E-35	446	0.244	0.287	5xteY.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
15	PDB:7o37B	0.726	0.897	4.566E-34	420	0.211	0.264	7o37B.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
16	PDB:5xteK	0.728	0.903	8.008E-33	419	0.202	0.253	5xteK.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
17	PDB:3hdiA	0.718	0.901	1.751E-31	414	0.200	0.254	3hdiA.pdb.gz	Crystal and solution structures of a prokaryotic M16B peptidase: an open and shut case.
18	PDB:1kb9A	0.727	0.877	3.280E-29	431	0.189	0.230	1kb9A.pdb.gz	SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
19	PDB:6ofsA	0.623	0.382	1.389E-22	905	0.124	0.072	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
20	PDB:7rjaB	0.558	0.775	5.816E-22	364	0.133	0.192	7rjaB.pdb.gz	Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20069	0.0	892	524	0.857	0.859	MPPA_RAT Mitochondrial-processing peptidase subunit alpha OS=Rattus norvegicus OX=10116 GN=Pmpca PE=1 SV=1
2	Q10713	0.0	1088	525	1.000	1.000	MPPA_HUMAN Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2
3	Q9DC61	0.0	971	524	0.912	0.914	MPPA_MOUSE Mitochondrial-processing peptidase subunit alpha OS=Mus musculus OX=10090 GN=Pmpca PE=1 SV=1
4	Q5SXN9	1.28e-114	342	271	0.345	0.668	Q5SXN9_HUMAN Peptidase, mitochondrial processing subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2
5	Q95XN2	3.33e-109	337	514	0.366	0.374	MPPA_CAEEL Mitochondrial-processing peptidase subunit alpha OS=Caenorhabditis elegans OX=6239 GN=mppa-1 PE=3 SV=2
6	P11914	6.73e-78	254	482	0.310	0.338	MPPA_YEAST Mitochondrial-processing peptidase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAS2 PE=1 SV=1
7	O94745	5.78e-63	216	502	0.288	0.301	MPPA_SCHPO Probable mitochondrial-processing peptidase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mas2 PE=3 SV=2
8	A0A1D8PN84	1.30e-62	215	522	0.280	0.282	A0A1D8PN84_CANAL Mitochondrial-processing protease subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAS2 PE=4 SV=1
9	Q9VFF0	1.78e-59	206	470	0.263	0.294	Q9VFF0_DROME GH01077p OS=Drosophila melanogaster OX=7227 GN=UQCR-C1 PE=1 SV=2
10	Q9ZU25	2.12e-56	198	503	0.314	0.328	MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPalpha1 PE=1 SV=1
11	Q03346	8.26e-56	196	489	0.312	0.335	MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus OX=10116 GN=Pmpcb PE=1 SV=3
12	Q9CXT8	2.98e-55	195	489	0.310	0.333	MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus OX=10090 GN=Pmpcb PE=1 SV=1
13	O75439	1.19e-54	193	489	0.265	0.284	MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2
14	Q4W6B5	1.15e-52	187	469	0.232	0.260	MPPB_DICDI Mitochondrial-processing peptidase subunit beta OS=Dictyostelium discoideum OX=44689 GN=mppB PE=1 SV=1
15	Q9P7X1	4.04e-52	186	457	0.270	0.311	MPPB_SCHPO Probable mitochondrial-processing peptidase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr1 PE=2 SV=1
16	G3V0E4	1.82e-51	184	490	0.259	0.278	G3V0E4_HUMAN Peptidase (Mitochondrial processing) beta, isoform CRA_c OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=1
17	Q42290	8.71e-51	184	531	0.253	0.250	MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPbeta PE=1 SV=2
18	A0A1D8PCY8	3.59e-50	181	467	0.270	0.304	A0A1D8PCY8_CANAL Mas1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAS1 PE=3 SV=1
19	O04308	1.19e-49	180	499	0.280	0.295	MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPalpha2 PE=1 SV=1
20	Q5BFD3	4.17e-49	178	479	0.244	0.267	Q5BFD3_EMENI Mitochondrial-processing peptidase subunit beta, mitochondrial [Precursor] (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00747 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10905 DUF2695	75	14.9	Protein of unknown function (DUF2695)
2	PF00675 Peptidase_M16	1e-41	153.8	Insulinase (Peptidase family M16)
3	PF05193 Peptidase_M16_C	4.2e-38	142.7	Peptidase M16 inactive domain
4	PF20490 SCGB3A	5.4e+02	12.2	Secretoglobin 3A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360782

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000249269	0.997	Mitochondrial-processing peptidase subunit beta
2	9606.ENSP00000297185	0.973	Stress-70 protein, mitochondrial
3	9606.ENSP00000356256	0.971	Mitochondrial import inner membrane translocase subunit Tim17-A
4	9606.ENSP00000373620	0.963	60 kDa heat shock protein, mitochondrial
5	9606.ENSP00000262030	0.961	ATP synthase subunit beta, mitochondrial
6	9606.ENSP00000269143	0.959	AFG3-like protein 2
7	9606.ENSP00000379999	0.958	Translocase of inner mitochondrial membrane 17B
8	9606.ENSP00000169551	0.956	Mitochondrial import inner membrane translocase subunit Tim21
9	9606.ENSP00000372005	0.955	Mitochondrial import inner membrane translocase subunit TIM14
10	9606.ENSP00000441875	0.954	Prohibitin-2
11	9606.ENSP00000315693	0.947	Mitochondrial import inner membrane translocase subunit TIM16
12	9606.ENSP00000445806	0.947	Mitochondrial import inner membrane translocase subunit TIM50
13	9606.ENSP00000366482	0.941	Frataxin, mitochondrial
14	9606.ENSP00000268704	0.939	Paraplegin
15	9606.ENSP00000203407	0.938	Cytochrome b-c1 complex subunit 1, mitochondrial
16	9606.ENSP00000270538	0.937	Mitochondrial import inner membrane translocase subunit TIM44
17	9606.ENSP00000479488	0.936	Prohibitin
18	9606.ENSP00000464522	0.928	Mitochondrial import inner membrane translocase subunit Tim23
19	9606.ENSP00000299166	0.926	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
20	9606.ENSP00000295079	0.921	m-AAA protease-interacting protein 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.997	catalytic activity
GO:0008233	0.986	peptidase activity
GO:0008237	0.984	metallopeptidase activity
GO:0004175	0.984	endopeptidase activity
GO:0004222	0.550	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016485	0.985	protein processing
GO:0009987	0.981	cellular process
GO:0007005	0.928	mitochondrion organization
GO:0006839	0.886	mitochondrial transport
GO:0072655	0.882	establishment of protein localization to mitochondrion
GO:0006886	0.853	intracellular protein transport
GO:0006626	0.840	protein targeting to mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.988	membrane
GO:0031090	0.973	organelle membrane
GO:0005740	0.958	mitochondrial envelope
GO:0031966	0.941	mitochondrial membrane
GO:0032991	0.926	protein-containing complex
GO:0070013	0.924	intracellular organelle lumen
GO:0098798	0.895	mitochondrial protein-containing complex
GO:0019866	0.887	organelle inner membrane
GO:0005743	0.868	mitochondrial inner membrane
GO:0005759	0.668	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.986	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.550	Metalloendopeptidases.

[back to server]