StarFunc result for job id Q11128

User Input

>input (374 residues)
MDPLGPAKPQWLWRRCLAGLLFQLLVAVCFFSYLRVSRDDATGSPRPGLMAVEPVTGAPN
GSRCQDSMATPAHPTLLILLWTWPFNTPVALPRCSEMVPGAADCNITADSSVYPQADAVI
VHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRSDSDIFT
PYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHK
PLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPP
DAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQQE
SRYQTVRSIAAWFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q11128	1.000	1.000	3.179E-82	374	1.000	1.000	Q11128.pdb.gz	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
2	AFDB:P51993	0.813	0.847	2.019E-70	359	0.853	0.889	P51993.pdb.gz	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
3	AFDB:P22083	0.749	0.534	4.311E-39	530	0.422	0.298	P22083.pdb.gz	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
4	AFDB:Q11127	0.769	0.667	5.897E-39	433	0.420	0.363	Q11127.pdb.gz	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
5	AFDB:Q62994	0.768	0.666	4.108E-38	433	0.417	0.360	Q62994.pdb.gz	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
6	AFDB:Q11131	0.747	0.719	4.374E-38	389	0.420	0.404	Q11131.pdb.gz	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
7	AFDB:Q712G6	0.744	0.752	7.218E-38	370	0.433	0.438	Q712G6.pdb.gz	FUT7_RAT Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1
8	AFDB:Q11130	0.740	0.807	1.191E-37	342	0.412	0.450	Q11130.pdb.gz	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
9	AFDB:O88819	0.767	0.798	2.525E-37	359	0.366	0.382	O88819.pdb.gz	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
10	AFDB:G3MZR2	0.744	0.811	5.700E-37	342	0.417	0.456	G3MZR2.pdb.gz	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
11	PDB:7scjA	0.300	0.221	4.732E-4	563	0.096	0.064	7scjA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
12	PDB:3okaA	0.364	0.361	6.890E-4	378	0.120	0.119	3okaA.pdb.gz	Acceptor substrate discrimination in phosphatidyl-myo-inositol mannoside synthesis: structural and mutational analysis of mannosyltransferase Corynebacterium glutamicum PimB'.
13	PDB:4nc9A	0.339	0.343	2.909E-3	369	0.102	0.103	4nc9A.pdb.gz
14	PDB:1f6dA	0.351	0.349	3.737E-3	376	0.075	0.074	1f6dA.pdb.gz	The structure of UDP-N-acetylglucosamine 2-epimerase reveals homology to phosphoglycosyl transferases.
15	PDB:4ambB	0.245	0.246	5.793E-3	373	0.107	0.107	4ambB.pdb.gz
16	PDB:4njmA	0.210	0.246	6.566E-3	303	0.107	0.132	4njmA.pdb.gz	Crystal structures and kinetics of Type III 3-phosphoglycerate dehydrogenase reveal catalysis by lysine.
17	PDB:5hvoA	0.359	0.305	7.442E-3	459	0.096	0.078	5hvoA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
18	PDB:5l0tA	0.304	0.316	1.018E-2	356	0.086	0.090	5l0tA.pdb.gz	Structural basis of Notch O-glucosylation and O-xylosylation by mammalian protein-O-glucosyltransferase 1 (POGLUT1).
19	PDB:4an4C	0.202	0.219	1.392E-2	328	0.094	0.107	4an4C.pdb.gz
20	PDB:7jlxA	0.168	0.321	1.482E-2	166	0.067	0.151	7jlxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P21217	0.0	669	361	0.885	0.917	FUT3_HUMAN 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 OS=Homo sapiens OX=9606 GN=FUT3 PE=1 SV=1
2	P51993	0.0	644	359	0.856	0.891	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
3	Q11128	0.0	773	374	1.000	1.000	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
4	Q6P7E6	0.0	642	359	0.850	0.886	Q6P7E6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
5	Q9P1W6	0.0	667	361	0.882	0.914	Q9P1W6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT3 PE=2 SV=1
6	Q11131	2.28e-85	266	389	0.393	0.378	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
7	Q712G6	4.76e-85	264	370	0.390	0.395	FUT7_RAT Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1
8	G3MZR2	1.05e-84	262	342	0.393	0.430	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
9	Q11130	3.30e-84	261	342	0.388	0.424	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
10	O88819	2.89e-81	254	359	0.353	0.368	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
11	Q99JB3	3.36e-81	254	359	0.353	0.368	FUT9_RAT 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
12	Q9Y231	1.17e-80	253	359	0.350	0.365	FUT9_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Homo sapiens OX=9606 GN=FUT9 PE=1 SV=2
13	Q11127	1.11e-74	239	433	0.428	0.370	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
14	P22083	8.33e-74	240	530	0.404	0.285	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
15	Q62994	2.53e-69	226	433	0.412	0.356	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
16	G5EDR5	6.87e-36	137	433	0.225	0.194	FUTA_CAEEL Alpha-(1,3)-fucosyltransferase fut-1 OS=Caenorhabditis elegans OX=6239 GN=fut-1 PE=1 SV=1
17	Q9VUL9	1.50e-35	137	503	0.257	0.191	FUCTA_DROME Glycoprotein 3-alpha-L-fucosyltransferase A OS=Drosophila melanogaster OX=7227 GN=FucTA PE=1 SV=2
18	G5EE06	4.25e-34	131	378	0.243	0.241	FUTD_CAEEL Alpha-(1,3)-fucosyltransferase fut-5 OS=Caenorhabditis elegans OX=6239 GN=fut-5 PE=1 SV=1
19	G5EFP5	8.11e-30	120	400	0.302	0.282	FUTC_CAEEL Alpha-(1,3)-fucosyltransferase fut-3 OS=Caenorhabditis elegans OX=6239 GN=fut-3 PE=1 SV=1
20	G5EEE1	3.03e-29	118	392	0.251	0.240	FUTE_CAEEL Alpha-(1,3)-fucosyltransferase fut-6 OS=Caenorhabditis elegans OX=6239 GN=fut-6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00852 Glyco_transf_10	1.9e-65	231.4	Glycosyltransferase family 10 (fucosyltransferase) C-term
2	PF17039 Glyco_tran_10_N	2.5e-31	119.8	Fucosyltransferase, N-terminal
3	PF00159 Hormone_3	2.5e+02	13.1	Pancreatic hormone peptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000466880

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312021	0.979	Galactoside 2-alpha-L-fucosyltransferase 1
2	9606.ENSP00000387498	0.979	Galactoside 2-alpha-L-fucosyltransferase 2
3	9606.ENSP00000369055	0.963	Beta-1,4-galactosyltransferase 1
4	9606.ENSP00000262915	0.960	ST3 beta-galactoside alpha-2,3-sialyltransferase 3
5	9606.ENSP00000436047	0.955	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
6	9606.ENSP00000305595	0.931	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
7	9606.ENSP00000420161	0.930	Beta-1,4-galactosyltransferase 4
8	9606.ENSP00000319636	0.919	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
9	9606.ENSP00000310696	0.912	Beta-1,4-galactosyltransferase 2
10	9606.ENSP00000480428	0.912	Beta-1,4-galactosyltransferase 3
11	9606.ENSP00000321874	0.911	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
12	9606.ENSP00000351602	0.910	Alpha-(1,3)-fucosyltransferase 4
13	9606.ENSP00000302599	0.909	Alpha-(1,3)-fucosyltransferase 9
14	9606.ENSP00000480884	0.906	Type 2 lactosamine alpha-2,3-sialyltransferase
15	9606.ENSP00000368917	0.904	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
16	9606.ENSP00000268164	0.902	Alpha-2,8-sialyltransferase 8B
17	9606.ENSP00000309270	0.902	Carbohydrate sulfotransferase 1
18	9606.ENSP00000379353	0.902	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
19	9606.ENSP00000483018	0.901	Histo-blood group ABO system transferase
20	9606.ENSP00000305603	0.851	Galactoside 3(4)-L-fucosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046920	1.000	alpha-(1->3)-fucosyltransferase activity
GO:0005515	0.891	protein binding
GO:0017083	0.885	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0044249	0.996	cellular biosynthetic process
GO:1901137	0.995	carbohydrate derivative biosynthetic process
GO:0005975	0.991	carbohydrate metabolic process
GO:0006486	0.988	protein glycosylation
GO:0016051	0.964	carbohydrate biosynthetic process
GO:0009311	0.953	oligosaccharide metabolic process
GO:0006643	0.948	membrane lipid metabolic process
GO:0006665	0.942	sphingolipid metabolic process
GO:0006487	0.935	protein N-linked glycosylation
GO:0009312	0.933	oligosaccharide biosynthetic process
GO:0006493	0.933	protein O-linked glycosylation
GO:0043603	0.846	amide metabolic process
GO:0006672	0.839	ceramide metabolic process
GO:0006664	0.419	glycolipid metabolic process
GO:0006687	0.343	glycosphingolipid metabolic process
GO:0009247	0.343	glycolipid biosynthetic process
GO:0065007	0.325	biological regulation
GO:0050794	0.313	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0005576	0.991	extracellular region
GO:0070062	0.927	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:14257	0.885	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = a beta-D-galactosyl-(1->4)-[alpha-L-fucosyl-(1->3)]-N-acetyl-beta-D-glucosaminyl derivative + GDP + H(+)
EC:2.4.1.152	0.885	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase.

[back to server]