StarFunc result for job id Q11130

User Input

>input (342 residues)
MNNAGHGPTRRLRGLGVLAGVALLAALWLLWLLGSAPRGTPAPQPTITILVWHWPFTDQP
PELPSDTCTRYGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWAS
MESPSHTHGLSHLRGIFNWVLSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNF
QERQLRARLYRQLAPHLRVDVFGRANGRPLCASCLVPTVAQYRFYLSFENSQHRDYITEK
FWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFA
WRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q11130	1.000	1.000	1.772E-76	342	1.000	1.000	Q11130.pdb.gz	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
2	AFDB:Q712G6	0.929	0.860	2.961E-67	370	0.810	0.749	Q712G6.pdb.gz	FUT7_RAT Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1
3	AFDB:Q11131	0.934	0.823	4.763E-66	389	0.795	0.699	Q11131.pdb.gz	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
4	AFDB:G3MZR2	0.958	0.958	7.337E-66	342	0.795	0.795	G3MZR2.pdb.gz	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
5	AFDB:Q11127	0.845	0.675	6.579E-40	433	0.471	0.372	Q11127.pdb.gz	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
6	AFDB:P22083	0.809	0.533	5.046E-39	530	0.462	0.298	P22083.pdb.gz	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
7	AFDB:Q62994	0.809	0.643	1.274E-38	433	0.480	0.379	Q62994.pdb.gz	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
8	AFDB:O88819	0.817	0.779	4.041E-37	359	0.377	0.359	O88819.pdb.gz	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
9	AFDB:P51993	0.807	0.770	1.154E-36	359	0.453	0.432	P51993.pdb.gz	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
10	AFDB:Q11128	0.813	0.746	4.488E-36	374	0.453	0.414	Q11128.pdb.gz	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
11	PDB:7sckB	0.393	0.258	1.453E-4	598	0.140	0.080	7sckB.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
12	PDB:7au2A	0.356	0.210	5.651E-4	686	0.170	0.085	7au2A.pdb.gz
13	PDB:7sckA	0.346	0.222	9.091E-3	642	0.111	0.059	7sckA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
14	PDB:1ya6A	0.341	0.315	1.094E-2	380	0.126	0.113	1ya6A.pdb.gz	Structural evidence of a passive base-flipping mechanism for AGT, an unusual GT-B glycosyltransferase.
15	PDB:7c6oA	0.161	0.066	1.164E-2	1173	0.123	0.036	7c6oA.pdb.gz
16	PDB:4ambB	0.210	0.197	1.685E-2	373	0.111	0.102	4ambB.pdb.gz
17	PDB:7ag1Z	0.146	0.159	2.441E-2	297	0.079	0.091	7ag1Z.pdb.gz
18	PDB:1bgtA	0.391	0.404	3.125E-2	329	0.099	0.103	1bgtA.pdb.gz
19	PDB:5weoA	0.238	0.119	3.125E-2	988	0.105	0.036	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
20	PDB:4an4C	0.184	0.186	4.814E-2	328	0.108	0.113	4an4C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3MZR2	0.0	542	342	0.795	0.795	FUT7_BOVIN Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
2	Q11130	0.0	696	342	1.000	1.000	FUT7_HUMAN Alpha-(1,3)-fucosyltransferase 7 OS=Homo sapiens OX=9606 GN=FUT7 PE=1 SV=1
3	Q11131	0.0	560	389	0.795	0.699	FUT7_MOUSE Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
4	Q712G6	0.0	572	370	0.810	0.749	FUT7_RAT Alpha-(1,3)-fucosyltransferase 7 OS=Rattus norvegicus OX=10116 GN=Fut7 PE=1 SV=1
5	Q11128	2.79e-84	261	374	0.427	0.390	FUT5_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT5 OS=Homo sapiens OX=9606 GN=FUT5 PE=1 SV=1
6	P51993	7.87e-82	254	359	0.424	0.404	FUT6_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
7	Q6P7E6	1.75e-81	253	359	0.421	0.401	Q6P7E6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT6 PE=1 SV=1
8	Q9P1W6	2.63e-81	253	361	0.406	0.385	Q9P1W6_HUMAN Fucosyltransferase OS=Homo sapiens OX=9606 GN=FUT3 PE=2 SV=1
9	P21217	2.74e-81	253	361	0.406	0.385	FUT3_HUMAN 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 OS=Homo sapiens OX=9606 GN=FUT3 PE=1 SV=1
10	Q11127	3.75e-81	255	433	0.485	0.383	FUT4_MOUSE Alpha-(1,3)-fucosyltransferase 4 OS=Mus musculus OX=10090 GN=Fut4 PE=1 SV=1
11	Q62994	3.68e-79	250	433	0.477	0.376	FUT4_RAT Alpha-(1,3)-fucosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=Fut4 PE=2 SV=1
12	P22083	4.51e-78	250	530	0.444	0.287	FUT4_HUMAN Alpha-(1,3)-fucosyltransferase 4 OS=Homo sapiens OX=9606 GN=FUT4 PE=1 SV=3
13	O88819	7.93e-77	241	359	0.380	0.362	FUT9_MOUSE 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
14	Q99JB3	1.01e-76	241	359	0.380	0.362	FUT9_RAT 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
15	Q9Y231	1.80e-76	241	359	0.377	0.359	FUT9_HUMAN 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Homo sapiens OX=9606 GN=FUT9 PE=1 SV=2
16	G5EE06	3.89e-39	144	378	0.269	0.243	FUTD_CAEEL Alpha-(1,3)-fucosyltransferase fut-5 OS=Caenorhabditis elegans OX=6239 GN=fut-5 PE=1 SV=1
17	Q9VUL9	1.29e-32	129	503	0.251	0.171	FUCTA_DROME Glycoprotein 3-alpha-L-fucosyltransferase A OS=Drosophila melanogaster OX=7227 GN=FucTA PE=1 SV=2
18	G5EEE1	3.81e-31	123	392	0.243	0.212	FUTE_CAEEL Alpha-(1,3)-fucosyltransferase fut-6 OS=Caenorhabditis elegans OX=6239 GN=fut-6 PE=1 SV=1
19	G5EDR5	7.97e-27	112	433	0.249	0.196	FUTA_CAEEL Alpha-(1,3)-fucosyltransferase fut-1 OS=Caenorhabditis elegans OX=6239 GN=fut-1 PE=1 SV=1
20	G5EFP5	6.88e-25	105	400	0.234	0.200	FUTC_CAEEL Alpha-(1,3)-fucosyltransferase fut-3 OS=Caenorhabditis elegans OX=6239 GN=fut-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00852 Glyco_transf_10	9.5e-53	190.1	Glycosyltransferase family 10 (fucosyltransferase) C-term
2	PF17039 Glyco_tran_10_N	7.4e-32	121.5	Fucosyltransferase, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318142

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480884	0.963	Type 2 lactosamine alpha-2,3-sialyltransferase
2	9606.ENSP00000331736	0.933	E-selectin
3	9606.ENSP00000379353	0.903	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
4	9606.ENSP00000312021	0.825	Galactoside 2-alpha-L-fucosyltransferase 1
5	9606.ENSP00000351602	0.822	Alpha-(1,3)-fucosyltransferase 4
6	9606.ENSP00000263686	0.794	P-selectin
7	9606.ENSP00000387498	0.777	Galactoside 2-alpha-L-fucosyltransferase 2
8	9606.ENSP00000353910	0.749	Alpha-(1,6)-fucosyltransferase
9	9606.ENSP00000339613	0.735	GDP-fucose protein O-fucosyltransferase 2
10	9606.ENSP00000376035	0.727	Zinc finger and BTB domain-containing protein 32
11	9606.ENSP00000236147	0.722	L-selectin
12	9606.ENSP00000415454	0.722	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
13	9606.ENSP00000360660	0.713	Neural proliferation differentiation and control protein 1
14	9606.ENSP00000359935	0.704	Fucose-1-phosphate guanylyltransferase
15	9606.ENSP00000341206	0.695	Carbohydrate sulfotransferase 4
16	9606.ENSP00000228463	0.692	P-selectin glycoprotein ligand 1
17	9606.ENSP00000436047	0.687	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
18	9606.ENSP00000332062	0.681	Sorting nexin-20
19	9606.ENSP00000356630	0.651	Headcase protein homolog
20	9606.ENSP00000365433	0.628	Transcription factor 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046920	1.000	alpha-(1->3)-fucosyltransferase activity
GO:0005515	0.845	protein binding
GO:0017083	0.675	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0070085	0.991	glycosylation
GO:0044238	0.988	primary metabolic process
GO:0044237	0.983	cellular metabolic process
GO:1901137	0.982	carbohydrate derivative biosynthetic process
GO:1901564	0.981	organonitrogen compound metabolic process
GO:0050789	0.975	regulation of biological process
GO:0050794	0.969	regulation of cellular process
GO:0043170	0.966	macromolecule metabolic process
GO:1901566	0.964	organonitrogen compound biosynthetic process
GO:0006486	0.948	protein glycosylation
GO:0040012	0.941	regulation of locomotion
GO:0002685	0.916	regulation of leukocyte migration
GO:0005975	0.907	carbohydrate metabolic process
GO:0002691	0.892	regulation of cellular extravasation
GO:0048522	0.890	positive regulation of cellular process
GO:0032501	0.804	multicellular organismal process
GO:0030155	0.728	regulation of cell adhesion
GO:0022407	0.703	regulation of cell-cell adhesion
GO:1903037	0.692	regulation of leukocyte cell-cell adhesion
GO:0009311	0.673	oligosaccharide metabolic process
GO:0045785	0.666	positive regulation of cell adhesion
GO:0022409	0.613	positive regulation of cell-cell adhesion
GO:0016051	0.561	carbohydrate biosynthetic process
GO:0009312	0.532	oligosaccharide biosynthetic process
GO:0006643	0.490	membrane lipid metabolic process
GO:0050896	0.485	response to stimulus
GO:1903039	0.355	positive regulation of leukocyte cell-cell adhesion
GO:0032502	0.336	developmental process
GO:0048856	0.321	anatomical structure development
GO:0006665	0.303	sphingolipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0031984	0.862	organelle subcompartment
GO:0098791	0.843	Golgi apparatus subcompartment
GO:0005802	0.643	trans-Golgi network
GO:0031982	0.336	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:14257	0.675	a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = a beta-D-galactosyl-(1->4)-[alpha-L-fucosyl-(1->3)]-N-acetyl-beta-D-glucosaminyl derivative + GDP + H(+)
EC:2.4.1.152	0.675	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase.

[back to server]