StarFunc result for job id Q11201

User Input

>input (340 residues)
MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCT
CTHCIGQRKLSAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKEL
FRVVPGNVDPMLEKRSVGCRRCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEAD
VGTKTTHHLVYPESFRELGDNVSMILVPFKTIDLEWVVSAITTGTISHTYIPVPAKIRVK
QDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHY
WENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q11201	1.000	1.000	1.155E-72	340	1.000	1.000	Q11201.pdb.gz	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
2	AFDB:Q02745	0.863	0.856	1.799E-65	343	0.832	0.825	Q02745.pdb.gz	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
3	AFDB:P54751	0.923	0.931	2.728E-64	337	0.815	0.822	P54751.pdb.gz	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
4	AFDB:Q11204	0.826	0.803	3.288E-45	350	0.494	0.480	Q11204.pdb.gz	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
5	AFDB:P61131	0.644	0.657	8.295E-22	333	0.232	0.237	P61131.pdb.gz	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
6	AFDB:Q11203	0.607	0.554	4.136E-21	375	0.288	0.261	Q11203.pdb.gz	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
7	AFDB:Q9UNP4	0.681	0.561	7.550E-20	418	0.229	0.187	Q9UNP4.pdb.gz	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
8	PDB:6aplC	0.642	0.706	1.114E-19	306	0.238	0.265	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
9	AFDB:Q9Y274	0.619	0.635	1.585E-19	331	0.241	0.248	Q9Y274.pdb.gz	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
10	AFDB:Q92183	0.657	0.414	1.908E-19	566	0.232	0.140	Q92183.pdb.gz	SIA7A_CHICK Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Gallus gallus OX=9031 GN=ST6GALNAC1 PE=1 SV=1
11	AFDB:Q9UJ37	0.622	0.569	2.159E-19	374	0.262	0.238	Q9UJ37.pdb.gz	SIA7B_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GALNAC2 PE=1 SV=1
12	PDB:3n29A	0.155	0.146	5.403E-2	371	0.091	0.084	3n29A.pdb.gz	Evolution of substrate specificity within a diverse family of beta/alpha-barrel-fold basic amino acid decarboxylases: X-ray structure determination of enzymes with specificity for L-arginine and carboxynorspermidine.
13	PDB:7mq8NJ	0.159	0.090	1.134E-1	827	0.106	0.044	7mq8NJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5l4gM	0.100	0.085	1.283E-1	415	0.076	0.063	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
15	PDB:7v3u6	0.104	0.064	1.283E-1	646	0.091	0.048	7v3u6.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
16	PDB:6xtx6	0.111	0.069	1.365E-1	679	0.132	0.066	6xtx6.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
17	PDB:2zwaB	0.101	0.063	1.643E-1	683	0.065	0.032	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
18	PDB:5bk4D	0.124	0.076	2.381E-1	661	0.112	0.057	5bk4D.pdb.gz	Cryo-EM structure of Mcm2-7 double hexamer on DNA suggests a lagging-strand DNA extrusion model.
19	PDB:6wgg5	0.113	0.075	2.381E-1	599	0.091	0.052	6wgg5.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
20	PDB:7tfkA	0.090	0.087	2.533E-1	360	0.076	0.072	7tfkA.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54751	0.0	575	337	0.815	0.822	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
2	Q02745	0.0	596	343	0.806	0.799	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
3	Q11201	0.0	714	340	1.000	1.000	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
4	Q11205	5.67e-126	367	350	0.509	0.494	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
5	Q11204	9.06e-125	363	350	0.509	0.494	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
6	Q16842	1.28e-123	360	350	0.503	0.489	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
7	Q11203	1.27e-29	118	375	0.224	0.203	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
8	P97325	1.42e-29	118	374	0.224	0.203	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
9	Q02734	1.45e-28	115	374	0.221	0.201	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
10	Q11206	6.89e-28	113	333	0.203	0.207	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1
11	Q91Y74	2.05e-27	112	333	0.194	0.198	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
12	P61131	1.66e-26	109	333	0.194	0.198	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
13	Q08BF4	3.67e-25	106	382	0.206	0.183	Q08BF4_DANRE ST3 beta-galactoside alpha-2,3-sialyltransferase 5, like OS=Danio rerio OX=7955 GN=zgc:153853 PE=2 SV=1
14	Q9Y274	2.64e-22	97.8	331	0.206	0.211	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
15	Q9UJ37	5.49e-20	92.0	374	0.200	0.182	SIA7B_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GALNAC2 PE=1 SV=1
16	Q9UNP4	8.14e-20	91.7	418	0.165	0.134	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
17	Q7T2X4	8.60e-20	92.0	446	0.176	0.135	Q7T2X4_ONCMY GalNAc alpha 2,6-sialyltransferase OS=Oncorhynchus mykiss OX=8022 GN=rtST6GalNAc PE=2 SV=1
18	Q64690	3.69e-17	83.6	359	0.194	0.184	SIA8D_CRIGR CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Cricetulus griseus OX=10029 GN=ST8SIA4 PE=1 SV=1
19	A0JMC3	3.81e-17	83.6	364	0.191	0.179	A0JMC3_DANRE Lactosylceramide alpha-2,3-sialyltransferase OS=Danio rerio OX=7955 GN=st3Gal-V PE=2 SV=1
20	F1RCA6	3.92e-17	83.6	364	0.191	0.179	F1RCA6_DANRE Lactosylceramide alpha-2,3-sialyltransferase isoform X1 OS=Danio rerio OX=7955 GN=st3Gal-V PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16489 GAIN	7.1e+02	10.9	GPCR-Autoproteolysis INducing (GAIN) domain
2	PF00777 Glyco_transf_29	8.7e-74	260.0	Glycosyltransferase family 29 (sialyltransferase)
3	PF18107 HTH_ABP1_N	78	14.4	Fission yeast centromere protein N-terminal domain
4	PF16278 zf-C2HE	1.4e+02	14.3	C2HE / C2H2 / C2HC zinc-binding finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428540

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415454	0.973	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
2	9606.ENSP00000389176	0.970	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
3	9606.ENSP00000304364	0.962	C1GALT1-specific chaperone 1
4	9606.ENSP00000379377	0.955	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
5	9606.ENSP00000312021	0.954	Galactoside 2-alpha-L-fucosyltransferase 1
6	9606.ENSP00000381699	0.944	Beta-1,3-galactosyltransferase 5
7	9606.ENSP00000484824	0.943	Mucin-1
8	9606.ENSP00000317027	0.939	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
9	9606.ENSP00000387498	0.939	Galactoside 2-alpha-L-fucosyltransferase 2
10	9606.ENSP00000390784	0.938	Beta-1,3-galactosyltransferase 4
11	9606.ENSP00000379353	0.934	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
12	9606.ENSP00000156626	0.931	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
13	9606.ENSP00000336733	0.929	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
14	9606.ENSP00000329214	0.928	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
15	9606.ENSP00000381008	0.926	Mucin-16
16	9606.ENSP00000362235	0.925	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
17	9606.ENSP00000306920	0.924	Beta-galactosidase
18	9606.ENSP00000414350	0.923	Mucin-20
19	9606.ENSP00000321343	0.922	Alpha-2,8-sialyltransferase 8E
20	9606.ENSP00000417583	0.922	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	0.999	sialyltransferase activity
GO:0003836	0.961	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity
GO:0005515	0.712	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006486	0.987	protein glycosylation
GO:0006664	0.960	glycolipid metabolic process
GO:0009247	0.954	glycolipid biosynthetic process
GO:0043603	0.948	amide metabolic process
GO:0030148	0.946	sphingolipid biosynthetic process
GO:0006687	0.945	glycosphingolipid metabolic process
GO:0006688	0.902	glycosphingolipid biosynthetic process
GO:0006672	0.838	ceramide metabolic process
GO:0046513	0.757	ceramide biosynthetic process
GO:0006493	0.471	protein O-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.998	Golgi membrane
GO:0005576	0.952	extracellular region
GO:0070062	0.913	extracellular exosome
GO:0031984	0.745	organelle subcompartment
GO:0098791	0.598	Golgi apparatus subcompartment
GO:0005795	0.580	Golgi stack
GO:0031985	0.525	Golgi cisterna
GO:0005802	0.417	trans-Golgi network
GO:1990676	0.365	Golgi trans cisterna membrane
GO:1990675	0.365	Golgi medial cisterna membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	0.999	Glycosyltransferases.
RHEA:21616	0.961	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.4	0.961	Transferred entry: 2.4.3.4.

[back to server]