StarFunc result for job id Q11203

User Input

>input (375 residues)
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRL
GFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARI
REFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDD
YDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLK
YIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIP
TLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLR
KLVKARVITDLSSGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q11203	1.000	1.000	5.456E-80	375	1.000	1.000	Q11203.pdb.gz	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
2	AFDB:Q9UNP4	0.737	0.663	3.700E-34	418	0.344	0.309	Q9UNP4.pdb.gz	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
3	AFDB:A0JMC3	0.718	0.739	2.260E-30	364	0.304	0.313	A0JMC3.pdb.gz	A0JMC3_DANRE Lactosylceramide alpha-2,3-sialyltransferase OS=Danio rerio OX=7955 GN=st3Gal-V PE=2 SV=1
4	AFDB:P61131	0.713	0.799	3.927E-30	333	0.301	0.339	P61131.pdb.gz	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
5	AFDB:Q9Y274	0.698	0.786	1.149E-28	331	0.293	0.332	Q9Y274.pdb.gz	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
6	AFDB:Q6EV30	0.670	0.656	2.124E-28	383	0.325	0.319	Q6EV30.pdb.gz
7	AFDB:Q02745	0.589	0.639	1.606E-21	343	0.232	0.254	Q02745.pdb.gz	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
8	AFDB:Q11201	0.553	0.606	7.009E-21	340	0.269	0.297	Q11201.pdb.gz	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
9	AFDB:Q11204	0.568	0.604	2.705E-20	350	0.237	0.254	Q11204.pdb.gz	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
10	AFDB:P54751	0.564	0.623	1.929E-19	337	0.227	0.252	P54751.pdb.gz	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
11	PDB:6aplC	0.600	0.722	2.656E-17	306	0.200	0.245	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:1kl7A	0.108	0.090	3.933E-2	509	0.099	0.073	1kl7A.pdb.gz	Structure and function of threonine synthase from yeast.
13	PDB:3b9xC	0.184	0.225	9.289E-2	283	0.069	0.092	3b9xC.pdb.gz	Structural basis for substrate specificity in group I nucleoside hydrolases
14	PDB:6dkhC	0.135	0.143	9.289E-2	346	0.075	0.081	6dkhC.pdb.gz	The crystal structure of L-idonate 5-dehydrogenase from Escherichia coli str. K-12 substr. MG1655
15	PDB:1u0rD	0.104	0.120	1.343E-1	301	0.045	0.056	1u0rD.pdb.gz
16	PDB:1wdlA	0.092	0.060	1.343E-1	715	0.032	0.017	1wdlA.pdb.gz	Structural basis for channelling mechanism of a fatty acid beta-oxidation multienzyme complex
17	PDB:2wtbA	0.084	0.056	1.428E-1	676	0.035	0.019	2wtbA.pdb.gz
18	PDB:6tnmA	0.098	0.060	1.428E-1	719	0.024	0.013	6tnmA.pdb.gz	Insights into the stability and substrate specificity of the E. coli aerobic beta-oxidation trifunctional enzyme complex.
19	PDB:4d9kD	0.099	0.101	1.614E-1	367	0.085	0.087	4d9kD.pdb.gz	Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
20	PDB:6kmsC	0.104	0.151	1.716E-1	210	0.056	0.100	6kmsC.pdb.gz	Structural insight into human N6amt1-Trm112 complex functioning as a protein methyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97325	0.0	753	374	0.971	0.973	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
2	Q02734	0.0	751	374	0.971	0.973	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
3	Q11203	0.0	773	375	1.000	1.000	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
4	Q9UNP4	4.01e-73	235	418	0.331	0.297	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
5	Q08BF4	1.74e-67	219	382	0.312	0.306	Q08BF4_DANRE ST3 beta-galactoside alpha-2,3-sialyltransferase 5, like OS=Danio rerio OX=7955 GN=zgc:153853 PE=2 SV=1
6	Q11206	1.48e-61	202	333	0.304	0.342	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1
7	P61131	2.58e-61	202	333	0.299	0.336	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
8	Q91Y74	2.90e-61	202	333	0.299	0.336	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
9	Q9Y274	6.12e-61	201	331	0.264	0.299	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
10	F1RCA6	8.83e-57	191	364	0.307	0.316	F1RCA6_DANRE Lactosylceramide alpha-2,3-sialyltransferase isoform X1 OS=Danio rerio OX=7955 GN=st3Gal-V PE=3 SV=1
11	A0JMC3	9.31e-57	191	364	0.307	0.316	A0JMC3_DANRE Lactosylceramide alpha-2,3-sialyltransferase OS=Danio rerio OX=7955 GN=st3Gal-V PE=2 SV=1
12	Q11201	1.38e-29	118	340	0.203	0.224	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
13	Q02745	7.38e-28	114	343	0.192	0.210	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
14	Q11205	3.38e-27	112	350	0.219	0.234	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
15	P54751	4.52e-27	111	337	0.195	0.217	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
16	Q11204	5.70e-27	111	350	0.211	0.226	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
17	Q16842	6.30e-26	108	350	0.208	0.223	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
18	Q9UJ37	1.32e-17	85.5	374	0.200	0.201	SIA7B_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GALNAC2 PE=1 SV=1
19	Q9NSC7	3.64e-17	85.1	600	0.221	0.138	SIA7A_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GALNAC1 PE=1 SV=1
20	Q92183	2.58e-13	73.6	566	0.104	0.069	SIA7A_CHICK Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Gallus gallus OX=9031 GN=ST6GALNAC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	8.2e-65	230.6	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010370194.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010370204.1	0.994	Beta-1,4-galactosyltransferase 2 isoform X1
2	61622.XP_010366945.1	0.992	Galactoside 2-alpha-L-fucosyltransferase 2
3	61622.XP_010376842.1	0.992	Beta-1,4-galactosyltransferase 1
4	61622.XP_010366937.1	0.991	Fucosyltransferase 1 (H blood group)
5	61622.XP_010367000.1	0.991	Beta-1,3-galactosyltransferase 5 isoform X1
6	61622.XP_010365426.1	0.989	Beta-1,4-galactosyltransferase 3
7	61622.XP_010352706.1	0.987	Beta-1,3-galactosyltransferase 1
8	61622.XP_010388076.1	0.980	Belongs to the glycosyltransferase 29 family.
9	61622.XP_010365501.1	0.970	Galactoside 3(4)-L-fucosyltransferase isoform X1
10	61622.XP_010366949.1	0.960	Galactoside 2-alpha-L-fucosyltransferase 2-like
11	61622.XP_010373859.1	0.924	Beta-1,3-galactosyltransferase 2
12	61622.XP_010356158.1	0.909	Beta-1,3-galactosyltransferase 4
13	61622.XP_010353700.1	0.900	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
14	61622.XP_010359498.1	0.890	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
15	61622.XP_010357520.1	0.884	Fucosyltransferase 9
16	61622.XP_010352738.1	0.879	Beta-1,3-galactosyltransferase 1-like
17	61622.XP_010359295.1	0.854	Belongs to the glycosyltransferase 29 family.
18	61622.XP_010351324.1	0.847	Belongs to the glycosyltransferase 29 family.
19	61622.XP_010365500.1	0.720	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 33 Proteins
20	61622.XP_010365503.1	0.720	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 27 Proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005488	0.984	binding
GO:0005515	0.930	protein binding
GO:0003836	0.732	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901137	0.992	carbohydrate derivative biosynthetic process
GO:0009987	0.991	cellular process
GO:1901566	0.991	organonitrogen compound biosynthetic process
GO:0044249	0.981	cellular biosynthetic process
GO:0036211	0.979	protein modification process
GO:0009059	0.975	macromolecule biosynthetic process
GO:0009100	0.952	glycoprotein metabolic process
GO:0070085	0.948	glycosylation
GO:0006486	0.935	protein glycosylation
GO:0006643	0.856	membrane lipid metabolic process
GO:1903509	0.813	liposaccharide metabolic process
GO:0046467	0.755	membrane lipid biosynthetic process
GO:0006664	0.753	glycolipid metabolic process
GO:0009247	0.486	glycolipid biosynthetic process
GO:0006687	0.482	glycosphingolipid metabolic process
GO:0030148	0.473	sphingolipid biosynthetic process
GO:0006688	0.455	glycosphingolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:21616	0.732	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.4	0.732	Transferred entry: 2.4.3.4.

[back to server]