StarFunc result for job id Q11206

User Input

>input (333 residues)
MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFG
NYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRC
VVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVE
NNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIA
ADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQIT
LKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61131	0.965	0.965	1.516E-63	333	0.901	0.901	P61131.pdb.gz	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
2	AFDB:Q9Y274	0.800	0.804	8.429E-31	331	0.363	0.366	Q9Y274.pdb.gz	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
3	AFDB:Q11203	0.807	0.720	4.508E-30	375	0.357	0.317	Q11203.pdb.gz	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
4	AFDB:Q9UNP4	0.809	0.650	2.892E-28	418	0.324	0.258	Q9UNP4.pdb.gz	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
5	AFDB:A0JMC3	0.783	0.719	7.308E-27	364	0.312	0.286	A0JMC3.pdb.gz	A0JMC3_DANRE Lactosylceramide alpha-2,3-sialyltransferase OS=Danio rerio OX=7955 GN=st3Gal-V PE=2 SV=1
6	AFDB:Q6EV30	0.746	0.653	1.847E-25	383	0.303	0.264	Q6EV30.pdb.gz
7	AFDB:Q02745	0.678	0.660	1.720E-23	343	0.231	0.224	Q02745.pdb.gz	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
8	AFDB:Q11201	0.676	0.663	9.787E-23	340	0.246	0.241	Q11201.pdb.gz	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
9	AFDB:Q11204	0.637	0.608	1.938E-22	350	0.276	0.263	Q11204.pdb.gz	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
10	AFDB:P54751	0.653	0.646	4.602E-21	337	0.255	0.252	P54751.pdb.gz	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
11	PDB:6aplC	0.668	0.722	4.099E-18	306	0.216	0.235	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:4d9kD	0.123	0.116	9.666E-2	367	0.087	0.079	4d9kD.pdb.gz	Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
13	PDB:7p44B	0.129	0.091	9.666E-2	700	0.084	0.040	7p44B.pdb.gz
14	PDB:1ultA	0.153	0.111	1.319E-1	533	0.120	0.075	1ultA.pdb.gz
15	PDB:6tnmA	0.106	0.064	1.914E-1	719	0.042	0.019	6tnmA.pdb.gz	Insights into the stability and substrate specificity of the E. coli aerobic beta-oxidation trifunctional enzyme complex.
16	PDB:7nnvA	0.135	0.142	2.611E-1	308	0.126	0.136	7nnvA.pdb.gz	A fragment-based approach to assess the ligandability of ArgB, ArgC, ArgD and ArgF in the L-arginine biosynthetic pathway of Mycobacterium tuberculosis
17	PDB:4q75A	0.122	0.106	2.778E-1	413	0.063	0.051	4q75A.pdb.gz
18	PDB:1tpyA	0.117	0.131	3.790E-1	285	0.120	0.140	1tpyA.pdb.gz	Structure of the cyclopropane synthase MmaA2 from Mycobacterium tuberculosis
19	PDB:1vb3A	0.137	0.119	4.033E-1	428	0.057	0.044	1vb3A.pdb.gz	Crystal Structure of Threonine Synthase from Escherichia coli
20	PDB:2q3oB	0.128	0.120	4.033E-1	367	0.069	0.063	2q3oB.pdb.gz	Ensemble refinement of protein crystal structures: validation and application.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61131	0.0	622	333	0.901	0.901	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
2	Q11206	0.0	692	333	1.000	1.000	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1
3	Q91Y74	0.0	615	333	0.895	0.895	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
4	Q9Y274	9.40e-64	207	331	0.354	0.356	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
5	Q11203	8.19e-62	203	375	0.351	0.312	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
6	P97325	3.73e-61	201	374	0.342	0.305	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
7	Q02734	6.15e-60	198	374	0.348	0.310	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
8	Q9UNP4	3.83e-47	166	418	0.285	0.227	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
9	Q08BF4	4.37e-46	162	382	0.291	0.254	Q08BF4_DANRE ST3 beta-galactoside alpha-2,3-sialyltransferase 5, like OS=Danio rerio OX=7955 GN=zgc:153853 PE=2 SV=1
10	A0JMC3	7.95e-41	148	364	0.282	0.258	A0JMC3_DANRE Lactosylceramide alpha-2,3-sialyltransferase OS=Danio rerio OX=7955 GN=st3Gal-V PE=2 SV=1
11	F1RCA6	8.47e-41	148	364	0.282	0.258	F1RCA6_DANRE Lactosylceramide alpha-2,3-sialyltransferase isoform X1 OS=Danio rerio OX=7955 GN=st3Gal-V PE=3 SV=1
12	Q11205	1.19e-28	115	350	0.204	0.194	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
13	Q11204	1.34e-28	115	350	0.204	0.194	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
14	Q11201	4.73e-28	113	340	0.207	0.203	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
15	Q16842	1.85e-27	112	350	0.201	0.191	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
16	P54751	9.12e-27	110	337	0.204	0.202	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
17	Q02745	9.94e-27	110	343	0.204	0.198	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
18	Q7T2X4	1.81e-14	76.3	446	0.210	0.157	Q7T2X4_ONCMY GalNAc alpha 2,6-sialyltransferase OS=Oncorhynchus mykiss OX=8022 GN=rtST6GalNAc PE=2 SV=1
19	Q8QH83	8.67e-14	73.6	381	0.192	0.168	Q8QH83_DANRE Alpha-2,8-sialyltransferase 8B OS=Danio rerio OX=7955 GN=siat8 PE=2 SV=1
20	Q9UJ37	2.19e-13	72.4	374	0.204	0.182	SIA7B_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GALNAC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	5e-56	201.8	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008971561.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008964940.1	0.992	Fucosyltransferase 1 (H blood group)
2	9597.XP_003846263.2	0.991	Fucosyltransferase 3 (Lewis blood group)
3	9597.XP_003814125.1	0.976	Belongs to the glycosyltransferase 11 family.
4	9597.XP_008964947.1	0.962	Galactoside 2-alpha-L-fucosyltransferase 2-like
5	9597.XP_003830166.1	0.929	Beta-1,4-galactosyltransferase 1
6	9597.XP_003824423.1	0.925	Alpha-(1,3)-fucosyltransferase 9
7	9597.XP_003819359.1	0.924	Fucosyltransferase 6
8	9597.XP_008975860.1	0.924	Catalyzes the transfer of Gal to GlcNAc-based acceptors with a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Can use glycolipid LC3Cer as an efficient acceptor (By similarity)
9	9597.XP_003824359.1	0.918	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. Involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins.
10	9597.XP_008970903.1	0.916	Fucosyltransferase 5
11	9597.XP_003820650.1	0.913	Beta-1,3-galactosyltransferase 2
12	9597.XP_003812875.1	0.911	Beta-1,4-galactosyltransferase 2
13	9597.XP_003825187.1	0.910	Beta-1,4-galactosyltransferase 4
14	9597.XP_003811890.1	0.894	Beta-1,4-galactosyltransferase 3
15	9597.XP_008963572.1	0.846	Belongs to the glycosyltransferase 29 family.
16	9597.XP_003820375.1	0.711	Von Willebrand factor
17	9597.XP_003810158.1	0.709	Asialoglycoprotein receptor 1 isoform X1
18	9597.XP_003810167.1	0.706	Asialoglycoprotein receptor 2
19	9597.XP_008974020.1	0.685	Mucin 20, cell surface associated
20	9597.XP_003807891.1	0.678	Osteoglycin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005515	0.949	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901137	0.994	carbohydrate derivative biosynthetic process
GO:1901566	0.993	organonitrogen compound biosynthetic process
GO:0044249	0.992	cellular biosynthetic process
GO:0070085	0.975	glycosylation
GO:0034645	0.975	cellular macromolecule biosynthetic process
GO:0006486	0.973	protein glycosylation
GO:0050789	0.951	regulation of biological process
GO:0050794	0.866	regulation of cellular process
GO:0006643	0.700	membrane lipid metabolic process
GO:0005975	0.604	carbohydrate metabolic process
GO:0030334	0.510	regulation of cell migration
GO:0009311	0.457	oligosaccharide metabolic process
GO:0006664	0.431	glycolipid metabolic process
GO:0048518	0.416	positive regulation of biological process
GO:0002685	0.407	regulation of leukocyte migration
GO:0016051	0.405	carbohydrate biosynthetic process
GO:0009247	0.396	glycolipid biosynthetic process
GO:0048522	0.391	positive regulation of cellular process
GO:0030155	0.380	regulation of cell adhesion
GO:0022407	0.370	regulation of cell-cell adhesion
GO:0002691	0.369	regulation of cellular extravasation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0005615	0.574	extracellular space
GO:0070062	0.497	extracellular exosome
GO:0043233	0.322	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.

[back to server]