StarFunc result for job id Q12756

User Input

>input (1690 residues)
MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHT
SPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIP
QLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVI
NEDPNNKLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSL
HERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDG
GTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDGERRQDIVLSGHFIKEEH
CVFRSDSRGGSEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQA
RQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLL
EQQRLDYESKLEALQKQMDSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFT
SLRDLLWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDRETRPF
PRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAEVPSSVIEDCDNVVTGGDPF
YDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADEEAPDYG
SGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADVGPSADEV
NNNTCSAVPPEGLLLDSSEKAALDGPLDAALDHLRLGNTFTFRVTVLQASSISAEYADIF
CQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHY
QQHPFPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTLTRPCPGPCHCKYDLLVYFE
ICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHETGSHIRWKEVRELVVG
RIRNTPETDESLIDPNILSLNILSSGYIHPAQDDRTFYQFEAAWDSSMHNSLLLNRVTPY
REKIYMTLSAYIEMENCTQPAVVTKDFCMVFYSRDAKLPASRSIRNLFGSGSLRASESNR
VTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELE
KLSLLQEVEKTRHYLLLREKLETAQRPVPEALSPAFSEDSESHGSSSASSPLSAEGRPSP
LEAPNERQRELAVKCLRLLTHTFNREYTHSHVCVSASESKLSEMSVTLLRDPSMSPLGVA
TLTPSSTCPSLVEGRYGATDLRTPQPCSRPASPEPELLPEADSKKLPSPARATETDKEPQ
RLLVPDIQEIRVSPIVSKKGYLHFLEPHTSGWARRFVVVRRPYAYMYNSDKDTVERFVLN
LATAQVEYSEDQQAMLKTPNTFAVCTEHRGILLQAASDKDMHDWLYAFNPLLAGTIRSKL
SRRRSAQMRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1ZAJ2	0.443	0.447	0.000	1670	0.575	0.582	A1ZAJ2.pdb.gz	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
2	AFDB:F1M4A4	0.528	0.523	0.000	1707	0.975	0.965	F1M4A4.pdb.gz	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
3	AFDB:O60333	0.763	0.714	0.000	1816	0.729	0.678	O60333.pdb.gz	KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5
4	AFDB:P23678	0.362	0.382	0.000	1584	0.510	0.544	P23678.pdb.gz	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
5	AFDB:O43896	0.215	0.325	6.442E-90	1103	0.330	0.506	O43896.pdb.gz	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
6	AFDB:Q9NGQ2	0.210	0.162	6.467E-86	2205	0.322	0.247	Q9NGQ2.pdb.gz	KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum OX=44689 GN=kif1 PE=1 SV=1
7	AFDB:G5EFQ4	0.206	0.368	2.777E-70	928	0.186	0.338	G5EFQ4.pdb.gz	G5EFQ4_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-6 PE=1 SV=1
8	AFDB:F8WLE0	0.201	0.325	6.421E-67	1034	0.175	0.285	F8WLE0.pdb.gz	KIF28_RAT Kinesin-like protein KIF28P OS=Rattus norvegicus OX=10116 GN=Kif28p PE=2 SV=1
9	AFDB:B1AVY7	0.231	0.295	8.270E-67	1312	0.197	0.254	B1AVY7.pdb.gz	KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus OX=10090 GN=Kif16b PE=1 SV=1
10	AFDB:Q96L93	0.231	0.295	4.179E-66	1317	0.188	0.241	Q96L93.pdb.gz	KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B PE=1 SV=2
11	PDB:7wrgA	0.199	0.406	2.682E-65	812	0.178	0.369	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.193	0.407	4.343E-64	783	0.177	0.382	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.165	0.405	2.937E-23	670	0.063	0.158	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:2ff4A	0.053	0.228	2.377E-6	379	0.027	0.121	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
15	PDB:2kb3A	0.053	0.561	7.819E-5	143	0.011	0.133	2kb3A.pdb.gz
16	PDB:3ljuX	0.049	0.212	1.007E-4	373	0.010	0.046	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:7rx9A	0.056	0.206	1.233E-4	432	0.011	0.044	7rx9A.pdb.gz
18	PDB:6bbpA	0.051	0.161	1.997E-3	520	0.012	0.040	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:6hhgA	0.051	0.212	6.398E-3	386	0.010	0.044	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
20	PDB:4mt6A	0.052	0.211	9.593E-3	389	0.008	0.036	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFR5	642	1957	0.232	0.200	A0A0B4KFR5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
2	A0A0B4KG24	602	1908	0.221	0.196	A0A0B4KG24_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
3	A0A0B4LGK5	636	1913	0.233	0.205	A0A0B4LGK5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
4	A0A8I6A6V5	3445	1697	0.976	0.972	A0A8I6A6V5_RAT Kinesin family member 1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=1
5	A1ZA18	636	1921	0.233	0.205	A1ZA18_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
6	A1ZAJ2	1858	1670	0.588	0.595	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
7	A4UZI0	641	1899	0.232	0.206	A4UZI0_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
8	E9Q4K7	613	1843	0.229	0.210	E9Q4K7_MOUSE Kinesin family member 13B OS=Mus musculus OX=10090 GN=Kif13b PE=1 SV=1
9	E9QDE5	1090	1763	0.332	0.318	E9QDE5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
10	F1M4A4	3434	1707	0.976	0.966	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
11	F1QBV5	1096	1770	0.332	0.317	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
12	F1QJ64	1109	1161	0.321	0.467	F1QJ64_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
13	O01349	634	1921	0.233	0.205	O01349_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=2 SV=1
14	O35071	999	1100	0.300	0.461	KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus OX=10090 GN=Kif1c PE=1 SV=2
15	O35787	957	1097	0.297	0.458	KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus OX=10116 GN=Kif1c PE=1 SV=1
16	O43896	999	1103	0.298	0.457	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
17	O60333	1083	1816	0.334	0.311	KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5
18	O88658	1061	1816	0.333	0.309	KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus OX=10116 GN=Kif1b PE=1 SV=2
19	P23678	1580	1584	0.507	0.540	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
20	P33173	3428	1695	0.973	0.971	KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus OX=10090 GN=Kif1a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12473 DUF3694	7.5e-40	148.3	Kinesin protein
2	PF00498 FHA	0.00037	32.1	FHA domain
3	PF12423 KIF1B	2.2e-10	51.9	Kinesin protein 1B
4	PF00225 Kinesin	8.3e-114	391.6	Kinesin motor domain
5	PF16183 Kinesin_assoc	3.7e-82	286.4	Kinesin-associated
6	PF16796 Microtub_bd	2.9e-20	84.2	Microtubule binding
7	PF00169 PH	1.8e-08	46.2	PH domain
8	PF16697 Yop-YscD_cpl	20	16.9	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000003918

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000006023	0.797	Plays a role in cytokinesis. Displays serine/threonine protein kinase activity
2	9555.ENSPANP00000013526	0.768	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
3	9555.ENSPANP00000009344	0.765	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
4	9555.ENSPANP00000005862	0.722	Kinesin-associated protein 3
5	9555.ENSPANP00000001321	0.707	Dynactin 1
6	9555.ENSPANP00000009581	0.699	Calpain 10
7	9555.ENSPANP00000009480	0.694	RAB3A, member RAS oncogene family
8	9555.ENSPANP00000012823	0.693	Allantoicase
9	9555.ENSPANP00000017798	0.690	Alanine-glyoxylate aminotransferase
10	9555.ENSPANP00000007559	0.685	Kinesin light chain 2
11	9555.ENSPANP00000007563	0.673	PTPRF interacting protein alpha 1
12	9555.ENSPANP00000001607	0.660	Kinesin family member 5A
13	9555.ENSPANP00000013297	0.660	Uncharacterized protein
14	9555.ENSPANP00000012699	0.659	Kinesin light chain 4
15	9555.ENSPANP00000020094	0.659	Kinesin-like protein
16	9555.ENSPANP00000019959	0.649	ADP-ribosylation factor-like 5B
17	9555.ENSPANP00000008352	0.642	PTPRF interacting protein alpha 3
18	9555.ENSPANP00000004036	0.637	MAP-kinase activating death domain
19	9555.ENSPANP00000013363	0.631	Protein regulator of cytokinesis 1
20	9555.ENSPANP00000018253	0.621	Rac GTPase activating protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	0.998	microtubule binding
GO:0042802	0.994	identical protein binding
GO:0003774	0.937	cytoskeletal motor activity
GO:0003777	0.719	microtubule motor activity
GO:0019894	0.381	kinesin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0046907	0.988	intracellular transport
GO:0007018	0.985	microtubule-based movement
GO:0099111	0.966	microtubule-based transport
GO:0010970	0.957	transport along microtubule
GO:0008088	0.810	axo-dendritic transport
GO:0098930	0.772	axonal transport
GO:0008089	0.744	anterograde axonal transport
GO:0032501	0.679	multicellular organismal process
GO:0065007	0.630	biological regulation
GO:0032502	0.624	developmental process
GO:0071840	0.608	cellular component organization or biogenesis
GO:0016043	0.581	cellular component organization
GO:0050789	0.548	regulation of biological process
GO:0050794	0.539	regulation of cellular process
GO:0048856	0.403	anatomical structure development
GO:0007275	0.367	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0120025	0.999	plasma membrane bounded cell projection
GO:0043229	0.997	intracellular organelle
GO:0043005	0.992	neuron projection
GO:0036477	0.986	somatodendritic compartment
GO:0043232	0.965	intracellular non-membrane-bounded organelle
GO:0030424	0.960	axon
GO:0043227	0.951	membrane-bounded organelle
GO:0044297	0.946	cell body
GO:0016020	0.941	membrane
GO:0032991	0.894	protein-containing complex
GO:0015630	0.878	microtubule cytoskeleton
GO:0045202	0.867	synapse
GO:0043025	0.851	neuronal cell body
GO:0043231	0.783	intracellular membrane-bounded organelle
GO:0012505	0.711	endomembrane system
GO:0031982	0.659	vesicle
GO:0097447	0.508	dendritic tree
GO:0030425	0.503	dendrite
GO:0031410	0.411	cytoplasmic vesicle
GO:0005829	0.327	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]