StarFunc result for job id Q12766

User Input

>input (1538 residues)
MQRTQPRPCYLNAPQQCPGAERPGRPTAGSHSFLLRPGPLAGSSPFALLDPLQAFEQFVW
VRSQARAGLLRLRQGSHAVTRCRPLPVRREGRRDGSPWRSVVCRYCRCSRQTGASVTTVS
LPSSSSSPGLDPRGPRQASVRSLRSEPVLLFLPFRTPYRDSEEGKREGLSRLRAVCRRAG
PRGRGSFSPRDARASPRLHFLVAAVTTGAASRRQRGARVRQPSPSSSRRAKRLRECERRS
LHAPPAMDASYDGTEVTVVMEEIEEAYCYTSPGPPKKKKKYKIHGEKTKKPRSAYLLYYY
DIYLKVQQELPHLPQSEINKKISESWRLLSVAERSYYLEKAKLEKEGLDPNSKLSALTAV
VPDIPGFRKILPRSDYIIIPKSSLQEDRSCPQLELCVAQNQMSPKGPPLVSNTAPETVPS
HAGMAEQCLAVEALAEEVGALTQSGAVQEIATSEILSQDVLLEDASLEVGESHQPYQTSL
VIEETLVNGSPDLPTGSLAVPHPQVGESVSVVTVMRDSSESSSSAPATQFIMLPLPAYSV
VENPTSIKLTTTYTRRGHGTCTSPGCSFTYVTRHKPPKCPTCGNFLGGKWIPKEKPAKVK
VELASGVSSKGSVVKRNQQPVTTEQNSSKENASKLTLENSEAVSQLLNVAPPREVGEESE
WEEVIISDAHVLVKEAPGNCGTAVTKTPVVKSGVQPEVTLGTTDNDSPGADVPTPSEGTS
TSSPLPAPKKPTGADLLTPGSRAPELKGRARGKPSLLAAARPMRAILPAPVNVGRGSSMG
LPRARQAFSLSDKTPSVRTCGLKPSTLKQLGQPIQQPSGPGEVKLPSGPSNRTSQVKVVE
VKPDMFPPYKYSCTVTLDLGLATSRGRGKCKNPSCSYVYTNRHKPRICPSCGVNLAKDRT
EKTTKAIEVSSPLPDVLNATEPLSTAQREIQRQSTLQLLRKVLQIPENESELAEVFALIH
ELNSSRLILSNVSEETVTIEQTSWSNYYESPSTQCLLCSSPLFKGGQNSLAGPQECWLLT
ASRLQTVTAQVKMCLNPHCLALHSFIDIYTGLFNVGNKLLVSLDLLFAIRNQIKLGEDPR
VSINVVLKSVQEQTEKTLTSEELSQLQELLCNGYWAFECLTVRDYNDMICGICGVAPKVE
MAQRSEENVLALKSVEFTWPEFLGSNEVNVEDFWATMETEVIEQVAFPASIPITKFDASV
IAPFFPPLMRGAVVVNTEKDKNLDVQPVPGSGSALVRLLQEGTCKLDEIGSYSEEKLQHL
LRQCGIPFGAEDSKDQLCFSLLALYESVQNGARAIRPPRHFTGGKIYKVCPHQVVCGSKY
LVRGESARDHVDLLASSRHWPPVYVVDMATSVALCADLCYPELTNQMWGRNQGCFSSPTE
PPVSVSCPELLDQHYTVDMTETEHSIQHPVTKTATRRIVHAGLQPNPGDPSAGHHSLALC
PELAPYATILASIVDSKPNGVRQRPIAFDNATHYYLYNRLMDFLTSREIVNRQIHDIVQS
CQPGEVVIRDTLYRLGVAQIKTETEEEGEEEEVAAVAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:X1WG57	0.038	0.030	9.460E-4	2615	0.109	0.064	X1WG57.pdb.gz
2	AFDB:P91943	0.041	0.083	1.054E-3	751	0.080	0.164	P91943.pdb.gz	PANG1_DROME Protein pangolin, isoforms A/H/I/S OS=Drosophila melanogaster OX=7227 GN=pan PE=1 SV=1
3	AFDB:O77086	0.034	0.034	8.164E-3	1571	0.105	0.102	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
4	AFDB:Q924A2	0.041	0.026	1.256E-2	2510	0.114	0.070	Q924A2.pdb.gz	CIC_MOUSE Protein capicua homolog OS=Mus musculus OX=10090 GN=Cic PE=1 SV=2
5	AFDB:Q9UTC4	0.035	0.054	1.558E-2	873	0.085	0.149	Q9UTC4.pdb.gz	YIDF_SCHPO Uncharacterized protein C227.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.15 PE=4 SV=1
6	AFDB:Q10172	0.029	0.025	1.832E-2	1794	0.109	0.094	Q10172.pdb.gz	PAN1_SCHPO Actin cytoskeleton-regulatory complex protein pan1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan1 PE=1 SV=1
7	AFDB:G4SNP7	0.032	0.034	2.153E-2	1427	0.075	0.081	G4SNP7.pdb.gz	G4SNP7_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=3
8	AFDB:Q9VMD0	0.037	0.035	3.313E-2	1659	0.122	0.113	Q9VMD0.pdb.gz	DAXX_DROME Daxx-like protein OS=Drosophila melanogaster OX=7227 GN=Daxx PE=1 SV=3
9	AFDB:Q9H7P9	0.034	0.037	3.895E-2	1386	0.105	0.117	Q9H7P9.pdb.gz	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3
10	AFDB:Q8NAP3	0.033	0.038	4.338E-2	1195	0.101	0.131	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
11	PDB:1j5nA	0.039	0.574	5.262E-2	93	0.014	0.226	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:6vlzQ	0.030	0.128	1.568	240	0.011	0.071	6vlzQ.pdb.gz	Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
13	PDB:1e1tA	0.039	0.099	2.052	485	0.020	0.064	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
14	PDB:1pfkA	0.024	0.092	2.413	320	0.008	0.037	1pfkA.pdb.gz	Crystal structure of the complex of phosphofructokinase from Escherichia coli with its reaction products.
15	PDB:1bbuA	0.041	0.095	2.687	486	0.022	0.070	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
16	PDB:1ci4A	0.032	0.286	2.687	89	0.010	0.169	1ci4A.pdb.gz
17	PDB:6yxxBS	0.028	0.186	3.713	161	0.005	0.050	6yxxBS.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:6i0mA	0.018	0.053	3.918	450	0.004	0.013	6i0mA.pdb.gz	A Nucleotide-Dependent Conformational Switch Controls the Polymerization of Human IMP Dehydrogenases to Modulate their Catalytic Activity.
19	PDB:5lj3C	0.042	0.065	4.364	882	0.017	0.029	5lj3C.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
20	PDB:7nacm	0.022	0.040	4.364	666	0.021	0.050	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2Z1R2	8.71e-04	45.8	340	0.012	0.056	SOX1B_DANRE Transcription factor Sox-1b OS=Danio rerio OX=7955 GN=sox1b PE=2 SV=1
2	P48433	0.001	45.1	312	0.012	0.061	SOX3_CHICK Transcription factor SOX-3 OS=Gallus gallus OX=9031 GN=SOX3 PE=2 SV=1
3	Q6DGL6	0.001	45.1	336	0.014	0.062	SOX1A_DANRE Transcription factor Sox-1a OS=Danio rerio OX=7955 GN=sox1a PE=2 SV=2
4	O95416	0.002	43.9	240	0.013	0.083	SOX14_HUMAN Transcription factor SOX-14 OS=Homo sapiens OX=9606 GN=SOX14 PE=1 SV=1
5	P48430	0.002	44.7	315	0.012	0.060	SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus OX=9031 GN=SOX2 PE=1 SV=1
6	Q04892	0.002	43.9	240	0.013	0.083	SOX14_MOUSE Transcription factor SOX-14 OS=Mus musculus OX=10090 GN=Sox14 PE=2 SV=2
7	Q9PSV6	0.002	44.7	316	0.012	0.060	Q9PSV6_CHICK SOX3 OS=Gallus gallus OX=9031 GN=Sox3 PE=2 SV=1
8	B0ZTE2	0.003	43.5	239	0.013	0.084	SOX14_XENLA Transcription factor Sox-14 OS=Xenopus laevis OX=8355 GN=sox14 PE=2 SV=1
9	O42569	0.003	43.9	311	0.012	0.061	SOX2_XENLA Transcription factor Sox-2 OS=Xenopus laevis OX=8355 GN=sox2 PE=1 SV=1
10	Q9W7R6	0.003	43.5	240	0.013	0.083	SOX14_CHICK Transcription factor SOX-14 OS=Gallus gallus OX=9031 GN=SOX14 PE=2 SV=1
11	Q6EJB7	0.004	43.5	300	0.012	0.060	SOX3_DANRE Transcription factor Sox-3 OS=Danio rerio OX=7955 GN=sox3 PE=1 SV=1
12	P47792	0.005	43.1	297	0.012	0.064	SX19A_DANRE Transcription factor Sox-19a OS=Danio rerio OX=7955 GN=sox19a PE=1 SV=2
13	Q09390	0.007	42.4	235	0.025	0.162	HMGBH_CAEEL High mobility group protein 1.2 OS=Caenorhabditis elegans OX=6239 GN=hmg-1.2 PE=1 SV=2
14	Q32PP9	0.007	42.4	238	0.012	0.080	SOX14_DANRE Transcription factor Sox-14 OS=Danio rerio OX=7955 GN=sox14 PE=2 SV=1
15	P55863	0.008	42.7	309	0.012	0.061	SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis OX=8355 GN=sox3-a PE=1 SV=1
16	Q2PG84	0.008	42.7	393	0.011	0.043	SOX1_XENLA Transcription factor Sox-1 OS=Xenopus laevis OX=8355 GN=sox1 PE=2 SV=1
17	P07746	0.009	41.6	204	0.016	0.118	HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
18	P53783	0.010	42.4	391	0.012	0.046	SOX1_MOUSE Transcription factor SOX-1 OS=Mus musculus OX=10090 GN=Sox1 PE=2 SV=2
19	Q6P0E1	0.010	42.4	315	0.012	0.057	SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio OX=7955 GN=sox2 PE=2 SV=1
20	Q8IB14	0.010	39.3	99	0.014	0.222	Q8IB14_PLAF7 High mobility group protein B2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0817900 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18717 CxC4	6.2e-09	47.2	CxC4 like cysteine cluster associated with KDZ transposases
2	PF00505 HMG_box	2.7e-07	42.2	HMG (high mobility group) box
3	PF09011 HMG_box_2	6.3e-08	44.4	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000012460

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007857	0.692	Uncharacterized protein
2	61853.ENSNLEP00000019482	0.692	NAD kinase 2, mitochondrial
3	61853.ENSNLEP00000011584	0.652	Neurensin 2
4	61853.ENSNLEP00000017346	0.650	Pleckstrin homology domain containing, family G (with RhoGef domain) member 3
5	61853.ENSNLEP00000020960	0.637	Solute carrier family 30 (zinc transporter), member 9
6	61853.ENSNLEP00000015918	0.559	Gamma-aminobutyric acid (GABA) A receptor, rho 2
7	61853.ENSNLEP00000004161	0.522	ADAM metallopeptidase with thrombospondin type 1 motif, 6
8	61853.ENSNLEP00000015896	0.522	Gamma-aminobutyric acid (GABA) A receptor, rho 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.996	organic cyclic compound binding
GO:0003676	0.993	nucleic acid binding
GO:0003677	0.983	DNA binding
GO:0140110	0.461	transcription regulator activity
GO:0043565	0.446	sequence-specific DNA binding
GO:0003700	0.355	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.921	regulation of cellular process
GO:0019222	0.748	regulation of metabolic process
GO:0080090	0.662	regulation of primary metabolic process
GO:0019219	0.577	regulation of nucleobase-containing compound metabolic process
GO:0008152	0.502	metabolic process
GO:0071704	0.491	organic substance metabolic process
GO:0044237	0.432	cellular metabolic process
GO:0006807	0.363	nitrogen compound metabolic process
GO:0044238	0.328	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.972	intracellular organelle lumen
GO:0031981	0.952	nuclear lumen
GO:0005654	0.935	nucleoplasm
GO:0005737	0.361	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]