StarFunc result for job id Q12767

User Input

>input (1356 residues)
MDLKEKHLGEPPSALGLSTRKALSVLKEQLEAVLEGHLRERKKCLTWKEVWRSSFLHHSN
RCSCFHWPGASLMLLAVLLLLGCCGGQPAGSRGVGLVNASALFLLLLLNLVLIGRQDRLK
RREVERRLRGIIDQIQDALRDGREIQWPSAMYPDLHMPFAPSWSLHWAYRDGHLVNLPVS
LLVEGDIIALRPGQESFASLRGIKDDEHIVLEPGDLFPPFSPPPSPRGEVERGPQSPQQH
RLFRVLETPVIDNIRWCLDMALSRPVTALDNERFTVQSVMLHYAVPVVLAGFLITNALRF
IFSAPGVTSWQYTLLQLQVNGVLPILPLLFPVLWVLATACGEARVLAQMSKASPSSLLAK
FSEDTLSSYTEAVSSQEMLRCIWGHFLRVLGGTSPTLSHSSSLLHSLGSVTVLCCVDKQG
ILSWPNPSPETVLFFSGKVEPPHSSHEDLTDGLSTRSFCHPEPHERDALLAGSLNNTLHL
SNEQERGDWPGEAPKPPEPYSHHKAHGRSKHPSGSNVSFSRDTEGGEEEPSKTQPGMESD
PYEAEDFVCDYHLEMLSLSQDQQNPSCIQFDDSNWQLHLTSLKPLGLNVLLNLCDASVTE
RLCRFSDHLCNIALQESHSAVLPVHVPWGLCELARLIGFTPGAKELFKQENHLALYRLPS
AETMKETSLGRLSCVTKRRPPLSHMISLFIKDTTTSTEQMLSHGTADVVLEACTDFWDGA
DIYPLSGSDRKKVLDFYQRACLSGYCSAFAYKPMNCALSSQLNGKCIELVQVPGQSSIFT
MCELPSTIPIKQNARRSSWSSDEGIGEVLEKEDCMQALSGQIFMGMVSSQYQARLDIVRL
IDGLVNACIRFVYFSLEDELKSKVFAEKMGLETGWNCHISLTPNGDMPGSEIPPSSPSHA
GSLHDDLNQVSRDDAEGLLLMEEEGHSDLISFQPTDSDIPSFLEDSNRAKLPRGIHQVRP
HLQNIDNVPLLVPLFTDCTPETMCEMIKIMQEYGEVTCCLGSSANLRNSCLFLQSDISIA
LDPLYPSRCSWETFGYATSISMAQASDGLSPLQLSGQLNSLPCSLTFRQEETISIIRLIE
QARHATYGIRKCFLFLLQCQLTLVVIQFLSCLVQLPPLLSTTDILWLSCFCYPLLSISLL
GKPPHSSIMSMATGKNLQSIPKKTQHYFLLCFLLKFSLTISSCLICFGFTLQSFCDSSRD
RNLTNCSSVMLPSNDDRAPAWFEDFANGLLSAQKLTAALIVLHTVFISITHVHRTKPLWR
KSPLTNLWWAVTVPVVLLGQVVQTAVDLQLWTHRDSHVHFGLEDVPLLTWLLGCLSLVLV
VVTNEIVKLHEIRVRVRYQKRQKLQFETKLGMNSPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TSH8	0.962	0.960	0.000	1360	0.955	0.952	Q7TSH8.pdb.gz	TMM94_MOUSE Transmembrane protein 94 OS=Mus musculus OX=10090 GN=Tmem94 PE=1 SV=1
2	AFDB:Q9UUY0	0.475	0.624	8.140E-26	997	0.119	0.161	Q9UUY0.pdb.gz	Q9UUY0_NEUCS Putative calcium P-type ATPase (Fragment) OS=Neurospora crassa OX=5141 GN=nca-1 PE=4 SV=1
3	PDB:5zmwA	0.409	0.518	4.476E-22	1000	0.128	0.173	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
4	PDB:7e7sA	0.425	0.533	6.910E-22	1020	0.118	0.157	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
5	PDB:7x20A	0.447	0.590	3.598E-21	986	0.110	0.151	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
6	PDB:3ixzA	0.431	0.557	7.527E-21	998	0.121	0.164	3ixzA.pdb.gz
7	PDB:8d3xA	0.432	0.567	2.651E-20	989	0.111	0.152	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
8	PDB:3b8eA	0.437	0.566	4.269E-19	998	0.107	0.145	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
9	AFDB:Q95XP5	0.419	0.454	2.604E-18	1234	0.115	0.126	Q95XP5.pdb.gz	Q95XP5_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=mca-3 PE=1 SV=1
10	PDB:7vpkA	0.408	0.502	1.151E-13	1055	0.118	0.152	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
11	PDB:7vh5A	0.311	0.458	4.055E-13	804	0.095	0.160	7vh5A.pdb.gz
12	PDB:6a69A	0.377	0.517	5.495E-13	911	0.105	0.156	6a69A.pdb.gz
13	PDB:7rd6A	0.391	0.535	5.495E-13	929	0.087	0.127	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
14	AFDB:Q38BL1	0.037	0.049	8.967E-1	891	0.031	0.047	Q38BL1.pdb.gz	Q38BL1_TRYB2 Phosphatidylinositol-4-phosphate 5-kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3440 PE=4 SV=1
15	AFDB:Q9UUD1	0.062	0.076	2.434	900	0.087	0.131	Q9UUD1.pdb.gz	SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sre1 PE=1 SV=1
16	AFDB:M0QZ12	0.042	0.057	2.896	807	0.052	0.087	M0QZ12.pdb.gz	M0QZ12_HUMAN GRAM domain containing 1A OS=Homo sapiens OX=9606 GN=GRAMD1A PE=1 SV=1
17	AFDB:P54677	0.035	0.039	2.896	1180	0.040	0.046	P54677.pdb.gz	PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum OX=44689 GN=pikD PE=3 SV=3
18	AFDB:A0A0C4DFX9	0.032	0.070	3.758	539	0.029	0.074	A0A0C4DFX9.pdb.gz	A0A0C4DFX9_HUMAN Negative elongation factor complex member A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=1
19	AFDB:Q63617	0.030	0.039	3.758	999	0.021	0.029	Q63617.pdb.gz	HYOU1_RAT Hypoxia up-regulated protein 1 OS=Rattus norvegicus OX=10116 GN=Hyou1 PE=1 SV=1
20	AFDB:Q9LT25	0.048	0.066	4.281	835	0.074	0.121	Q9LT25.pdb.gz	PR40C_ARATH Pre-mRNA-processing protein 40C OS=Arabidopsis thaliana OX=3702 GN=PRP40C PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TSH8	0.0	2541	1360	0.954	0.951	TMM94_MOUSE Transmembrane protein 94 OS=Mus musculus OX=10090 GN=Tmem94 PE=1 SV=1
2	Q76NN8	0.027	41.6	1228	0.057	0.063	Q76NN8_PLAF7 Calcium-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0106300 PE=4 SV=1
3	Q5AW66	0.047	40.8	1062	0.027	0.035	Q5AW66_EMENI High affinity Ca2+/Mn2+ P-type ATPase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07464 PE=4 SV=1
4	Q642Z0	0.085	39.7	994	0.035	0.048	Q642Z0_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=cb279 PE=1 SV=1
5	Q9UUY0	0.16	38.9	997	0.026	0.035	Q9UUY0_NEUCS Putative calcium P-type ATPase (Fragment) OS=Neurospora crassa OX=5141 GN=nca-1 PE=4 SV=1
6	P22700	0.18	38.9	1020	0.026	0.034	ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2
7	A6QP89	0.20	38.5	1198	0.030	0.034	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
8	P13586	0.24	38.1	950	0.045	0.064	ATC1_YEAST Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMR1 PE=1 SV=1
9	Q64518	0.24	38.5	999	0.024	0.033	AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus OX=10090 GN=Atp2a3 PE=1 SV=4
10	P18596	0.27	38.1	999	0.024	0.033	AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2a3 PE=1 SV=3
11	Q93084	0.29	38.1	999	0.024	0.033	AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2A3 PE=1 SV=3
12	Q9UUY2	0.30	38.1	1385	0.018	0.018	Q9UUY2_NEUCS P-type Ca(2+) transporter (Fragment) OS=Neurospora crassa OX=5141 GN=nca-2 PE=4 SV=1
13	Q6Q477	0.38	37.7	1205	0.021	0.023	AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus OX=10090 GN=Atp2b4 PE=1 SV=1
14	F7AAP4	0.45	37.4	1166	0.021	0.024	F7AAP4_MOUSE Calcium-transporting ATPase OS=Mus musculus OX=10090 GN=Atp2b4 PE=1 SV=1
15	P04191	0.49	37.4	1001	0.027	0.036	AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus OX=9986 GN=ATP2A1 PE=1 SV=1
16	O14983	0.50	37.4	1001	0.027	0.036	AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2A1 PE=1 SV=1
17	Q64578	0.51	37.4	994	0.027	0.036	AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp2a1 PE=1 SV=1
18	Q8R429	0.52	37.4	994	0.027	0.036	AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus OX=10090 GN=Atp2a1 PE=1 SV=1
19	A0A0R4IQS8	0.53	37.4	1041	0.027	0.035	A0A0R4IQS8_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=SERCA2 PE=1 SV=1
20	B6CAM1	0.54	37.4	994	0.027	0.036	B6CAM1_RABIT Calcium-transporting ATPase OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00689 Cation_ATPase_C	0.0062	27.8	Cation transporting ATPase, C-terminus
2	PF00122 E1-E2_ATPase	3.7e+02	12.0	E1-E2 ATPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313885

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325355	0.820	Caskin-2
2	9606.ENSP00000326693	0.790	Mitochondrial coenzyme A transporter SLC25A42
3	9606.ENSP00000419782	0.768	Cyclin-dependent-like kinase 5
4	9606.ENSP00000344572	0.757	Acidic fibroblast growth factor intracellular-binding protein
5	9606.ENSP00000255324	0.689	RING finger protein 17
6	9606.ENSP00000162044	0.684	Transmembrane protein 161A
7	9606.ENSP00000414236	0.617	Heat shock factor binding protein 1 like 1
8	9606.ENSP00000356842	0.599	Cell surface A33 antigen
9	9606.ENSP00000450310	0.586	G-protein coupled receptor 84
10	9606.ENSP00000335229	0.560	Putative uncharacterized protein C17orf82
11	9606.ENSP00000264674	0.559	MDS1 and EVI1 complex locus protein EVI1
12	9606.ENSP00000317144	0.554	Progesterone-induced-blocking factor 1
13	9606.ENSP00000334849	0.543	Transmembrane protein 104
14	9606.ENSP00000457408	0.530	Uncharacterized protein KIAA0513
15	9606.ENSP00000265036	0.525	DEP domain containing 1B
16	9606.ENSP00000430338	0.523	Integrator complex subunit 8
17	9606.ENSP00000229922	0.521	Adenylyl cyclase-associated protein 2
18	9606.ENSP00000361883	0.521	Adenylyl cyclase-associated protein 1
19	9606.ENSP00000239449	0.514	Protocadherin beta-14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	0.999	ATP-dependent activity
GO:0005215	0.999	transporter activity
GO:0005515	0.999	protein binding
GO:0022857	0.987	transmembrane transporter activity
GO:0022804	0.975	active transmembrane transporter activity
GO:0008324	0.975	monoatomic cation transmembrane transporter activity
GO:0042626	0.973	ATPase-coupled transmembrane transporter activity
GO:0022853	0.970	active monoatomic ion transmembrane transporter activity
GO:0019829	0.962	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0046873	0.892	metal ion transmembrane transporter activity
GO:1901702	0.816	salt transmembrane transporter activity
GO:0015662	0.792	P-type ion transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007275	0.907	multicellular organism development
GO:0048731	0.879	system development
GO:0048513	0.822	animal organ development
GO:0009888	0.817	tissue development
GO:0072359	0.817	circulatory system development
GO:0009987	0.721	cellular process
GO:0007507	0.694	heart development
GO:0035050	0.677	embryonic heart tube development
GO:0065007	0.434	biological regulation
GO:0050794	0.368	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.996	membrane
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0012505	0.975	endomembrane system
GO:0031090	0.962	organelle membrane
GO:0071944	0.775	cell periphery
GO:0005886	0.773	plasma membrane
GO:0031982	0.666	vesicle
GO:0005634	0.451	nucleus
GO:0098588	0.384	bounding membrane of organelle
GO:0030659	0.329	cytoplasmic vesicle membrane
GO:0032991	0.322	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.973	Translocases.

[back to server]