StarFunc result for job id Q12768

User Input

>input (1159 residues)
MLDFLAENNLCGQAILRIVSCGNAIIAELLRLSEFIPAVFRLKDRADQQKYGDIIFDFSY
FKGPELWESKLDAKPELQDLDEEFRENNIEIVTRFYLAFQSVHKYIVDLNRYLDDLNEGV
YIQQTLETVLLNEDGKQLLCEALYLYGVMLLVIDQKIEGEVRERMLVSYYRYSAARSSAD
SNMDDICKLLRSTGYSSQPGAKRPSNYPESYFQRVPINESFISMVIGRLRSDDIYNQVSA
YPLPEHRSTALANQAAMLYVILYFEPSILHTHQAKMREIVDKYFPDNWVISIYMGITVNL
VDAWEPYKAAKTALNNTLDLSNVREQASRYATVSERVHAQVQQFLKEGYLREEMVLDNIP
KLLNCLRDCNVAIRWLMLHTADSACDPNNKRLRQIKDQILTDSRYNPRILFQLLLDTAQF
EFILKEMFKQMLSEKQTKWEHYKKEGSERMTELADVFSGVKPLTRVEKNENLQAWFREIS
KQILSLNYDDSTAAGRKTVQLIQALEEVQEFHQLESNLQVCQFLADTRKFLHQMIRTINI
KEEVLITMQIVGDLSFAWQLIDSFTSIMQESIRVNPSMVTKLRATFLKLASALDLPLLRI
NQANSPDLLSVSQYYSGELVSYVRKVLQIIPESMFTSLLKIIKLQTHDIIEVPTRLDKDK
LRDYAQLGPRYEVAKLTHAISIFTEGILMMKTTLVGIIKVDPKQLLEDGIRKELVKRVAF
ALHRGLIFNPRAKPSELMPKLKELGATMDGFHRSFEYIQDYVNIYGLKIWQEEVSRIINY
NVEQECNNFLRTKIQDWQSMYQSTHIPIPKFTPVDESVTFIGRLCREILRITDPKMTCHI
DQLNTWYDMKTHQEVTSSRLFSEIQTTLGTFGLNGLDRLLCFMIVKELQNFLSMFQKIIL
RDRTVQDTLKTLMNAVSPLKSIVANSNKIYFSAIAKTQKIWTAYLEAIMKVGQMQILRQQ
IANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDPSLPYPKEDNTLLYEITAYLEAA
GIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNLGMVCRKPTDPVDWPPLVLGL
LTLLKQFHSRYTEQFLALIGQFICSTVEQCTSQKIPEIPADVVGALLFLEDYVRYTKLPR
RVAEAHVPNFIFDEFRTVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12768	1.000	1.000	0.000	1159	1.000	1.000	Q12768.pdb.gz	WASC5_HUMAN WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=WASHC5 PE=1 SV=1
2	AFDB:Q7ZVM1	0.997	0.997	0.000	1159	0.876	0.876	Q7ZVM1.pdb.gz	WASC5_DANRE WASH complex subunit 5 OS=Danio rerio OX=7955 GN=washc5 PE=2 SV=1
3	AFDB:Q54IR8	0.956	0.952	1.034E-86	1164	0.504	0.502	Q54IR8.pdb.gz	WASC5_DICDI WASH complex subunit 5 OS=Dictyostelium discoideum OX=44689 GN=washc5 PE=1 SV=1
4	AFDB:Q9VUY8	0.947	0.922	4.310E-79	1191	0.444	0.432	Q9VUY8.pdb.gz	WASC5_DROME WASH complex subunit homolog 5 OS=Drosophila melanogaster OX=7227 GN=Strump PE=1 SV=1
5	AFDB:Q8K1X4	0.362	0.368	1.054E-14	1134	0.111	0.114	Q8K1X4.pdb.gz	NCKPL_MOUSE Nck-associated protein 1-like OS=Mus musculus OX=10090 GN=Nckap1l PE=1 SV=1
6	AFDB:P55162	0.348	0.357	1.622E-14	1126	0.119	0.123	P55162.pdb.gz	HEM_DROME Membrane-associated protein Hem OS=Drosophila melanogaster OX=7227 GN=Hem PE=2 SV=1
7	AFDB:Q869Q3	0.344	0.344	3.324E-14	1160	0.112	0.112	Q869Q3.pdb.gz	NAPA_DICDI Nck-associated protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=napA PE=1 SV=1
8	AFDB:P55163	0.334	0.338	9.079E-14	1141	0.119	0.121	P55163.pdb.gz	GEX3_CAEEL Membrane-associated protein gex-3 OS=Caenorhabditis elegans OX=6239 GN=gex-3 PE=1 SV=2
9	AFDB:B0S6R1	0.338	0.345	1.300E-13	1128	0.114	0.117	B0S6R1.pdb.gz	NCKP1_DANRE Nck-associated protein 1 OS=Danio rerio OX=7955 GN=nckap1 PE=3 SV=1
10	PDB:7useB	0.351	0.365	2.951E-13	1099	0.123	0.129	7useB.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
11	AFDB:Q5S2C4	0.331	0.284	6.452E-11	1425	0.117	0.095	Q5S2C4.pdb.gz	NCKP1_ARATH Protein NAP1 OS=Arabidopsis thaliana OX=3702 GN=NAP1 PE=1 SV=2
12	PDB:7usdA	0.232	0.228	2.463E-7	1185	0.127	0.124	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
13	PDB:6vaeA	0.096	0.094	6.602E-4	1198	0.112	0.109	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
14	PDB:7qdrB	0.081	0.080	1.507E-3	1212	0.114	0.109	7qdrB.pdb.gz
15	PDB:7jq9A	0.087	0.063	1.678E-3	2427	0.114	0.054	7jq9A.pdb.gz
16	PDB:7kzvV	0.088	0.088	2.773E-3	1155	0.122	0.122	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
17	PDB:5ijnD	0.090	0.098	3.201E-3	1028	0.129	0.146	5ijnD.pdb.gz
18	PDB:7mp5A	0.100	0.083	4.116E-3	1629	0.109	0.077	7mp5A.pdb.gz
19	PDB:7qenD	0.076	0.081	5.291E-3	1050	0.115	0.127	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
20	PDB:7zf1B	0.107	0.106	6.107E-3	1179	0.111	0.109	7zf1B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AFP0	0.0	2260	1161	0.944	0.942	A0A8I6AFP0_RAT WASH complex subunit 5 OS=Rattus norvegicus OX=10116 GN=Washc5 PE=1 SV=1
2	E7EQI7	0.0	2095	1011	0.872	1.000	E7EQI7_HUMAN WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=WASHC5 PE=1 SV=1
3	F1M1B3	0.0	2276	1154	0.952	0.956	F1M1B3_RAT WASH complex subunit 5 OS=Rattus norvegicus OX=10116 GN=Washc5 PE=1 SV=3
4	Q12768	0.0	2399	1159	1.000	1.000	WASC5_HUMAN WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=WASHC5 PE=1 SV=1
5	Q54IR8	0.0	1150	1164	0.504	0.502	WASC5_DICDI WASH complex subunit 5 OS=Dictyostelium discoideum OX=44689 GN=washc5 PE=1 SV=1
6	Q7ZVM1	0.0	2117	1159	0.877	0.877	WASC5_DANRE WASH complex subunit 5 OS=Danio rerio OX=7955 GN=washc5 PE=2 SV=1
7	Q8C2E7	0.0	2300	1159	0.958	0.958	WASC5_MOUSE WASH complex subunit 5 OS=Mus musculus OX=10090 GN=Washc5 PE=1 SV=2
8	Q9VUY8	0.0	979	1191	0.450	0.438	WASC5_DROME WASH complex subunit homolog 5 OS=Drosophila melanogaster OX=7227 GN=Strump PE=1 SV=1
9	Q8RXA7	0.48	37.0	1187	0.022	0.022	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
10	Q5RHB5	3.2	34.3	1447	0.014	0.011	IRAG2_DANRE Inositol 1,4,5-triphosphate receptor associated 2 OS=Danio rerio OX=7955 GN=irag2 PE=1 SV=2
11	O70439	6.0	32.7	261	0.022	0.096	STX7_MOUSE Syntaxin-7 OS=Mus musculus OX=10090 GN=Stx7 PE=1 SV=3
12	A0A075B730	6.9	33.5	5063	0.021	0.005	A0A075B730_HUMAN Epiplakin 1 OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=2
13	P58107	7.0	33.5	5088	0.021	0.005	EPIPL_HUMAN Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3
14	F4JF14	7.3	33.1	953	0.026	0.031	ENOL1_ARATH Protein ENHANCER OF LHP1 1 OS=Arabidopsis thaliana OX=3702 GN=EOL1 PE=1 SV=1
15	Q03210	7.6	33.1	505	0.028	0.065	NGL3_YEAST Probable RNA exonuclease NGL3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NGL3 PE=1 SV=1
16	P04173	9.3	32.7	364	0.022	0.069	LEU3_YEAST 3-isopropylmalate dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LEU2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20201 DUF6563	2.9e+02	12.5	Family of unknown function (DUF6563)
2	PF04551 GcpE	7.5e+02	10.6	GcpE protein
3	PF10266 Strumpellin	0	1660.2	Hereditary spastic paraplegia protein strumpellin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318016

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240079	0.999	WASH complex subunit 3
2	9606.ENSP00000363482	0.999	WASH complex subunit 2C
3	9606.ENSP00000484713	0.999	WASH complex subunit 4
4	9606.ENSP00000485627	0.999	WASH complex subunit 1
5	9606.ENSP00000282633	0.996	WASH complex subunit 2A
6	9606.ENSP00000401010	0.977	F-actin-capping protein subunit beta
7	9606.ENSP00000263168	0.966	F-actin-capping protein subunit alpha-1
8	9606.ENSP00000238256	0.912	FK506-binding protein 15
9	9606.ENSP00000362480	0.879	Vacuolar protein sorting-associated protein 26A
10	9606.ENSP00000299138	0.845	Vacuolar protein sorting-associated protein 35
11	9606.ENSP00000480893	0.832	Spastin
12	9606.ENSP00000480853	0.821	Vacuolar protein sorting-associated protein 29
13	9606.ENSP00000261889	0.819	Sorting nexin-1
14	9606.ENSP00000485442	0.819	Acts as a nucleation-promoting factor at the surface of endosomes, where it recruits and activates the Arp2/3 complex to induce actin polymerization, playing a key role in the fission of tubules that serve as transport intermediates during endosome sorting. Involved in endocytic trafficking of EGF. Its assembly in the WASH core complex seems to inhibit its NPF activity and via WASHC2 is required for its membrane targeting. Involved in transferrin receptor recycling. Regulates the trafficking of endosomal alpha5beta1 integrin to the plasma membrane and involved in invasive cell migratio [...]
15	9606.ENSP00000351777	0.787	Transitional endoplasmic reticulum ATPase
16	9606.ENSP00000317542	0.776	Putative WAS protein family homolog 4
17	9606.ENSP00000360268	0.764	Delta-1-pyrroline-5-carboxylate synthase
18	9606.ENSP00000438346	0.756	Receptor expression-enhancing protein 1
19	9606.ENSP00000365891	0.743	Wiskott-Aldrich syndrome protein
20	9606.ENSP00000402935	0.739	TBC1 domain family member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0065007	0.977	biological regulation
GO:0050789	0.973	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0051128	0.848	regulation of cellular component organization
GO:0051179	0.753	localization
GO:0016043	0.721	cellular component organization
GO:0051234	0.663	establishment of localization
GO:0006810	0.575	transport
GO:0048518	0.512	positive regulation of biological process
GO:0051641	0.503	cellular localization
GO:0048522	0.469	positive regulation of cellular process
GO:0016192	0.386	vesicle-mediated transport
GO:0046907	0.380	intracellular transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0031982	0.997	vesicle
GO:0032991	0.995	protein-containing complex
GO:0031981	0.991	nuclear lumen
GO:0005768	0.985	endosome
GO:0071203	0.977	WASH complex
GO:0005654	0.974	nucleoplasm
GO:0005829	0.950	cytosol
GO:0016020	0.859	membrane
GO:0005769	0.770	early endosome
GO:0070062	0.525	extracellular exosome
GO:0043232	0.446	intracellular non-membrane-bounded organelle
GO:0120025	0.320	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]