StarFunc result for job id Q12769

User Input

>input (1436 residues)
MLHLSAAPPAPPPEVTATARPCLCSVGRRGDGGKMAAAGALERSFVELSGAERERPRHFR
EFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLD
INLLNNAIRLKFQNCSVLPGGVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSELVVD
SQMQSIFTDIGKVDFTDPCNYQLIPAVPGISPNSTASTAWLSSDGEALFALPCASGGIFV
LKLPPYDIPGMVSVVELKQSSVMQRLLTGWMPTAIRGDQSPSDRPLSLAVHCVEHDAFIF
ALCQDHKLRMWSYKEQMCLMVADMLEYVPVKKDLRLTAGTGHKLRLAYSPTMGLYLGIYM
HAPKRGQFCIFQLVSTESNRYSLDHISSLFTSQETLIDFALTSTDIWALWHDAENQTVVK
YINFEHNVAGQWNPVFMQPLPEEEIVIRDDQDPREMYLQSLFTPGQFTNEALCKALQIFC
RGTERNLDLSWSELKKEVTLAVENELQGSVTEYEFSQEEFRNLQQEFWCKFYACCLQYQE
ALSHPLALHLNPHTNMVCLLKKGYLSFLIPSSLVDHLYLLPYENLLTEDETTISDDVDIA
RDVICLIKCLRLIEESVTVDMSVIMEMSCYNLQSPEKAAEQILEDMITIDVENVMEDICS
KLQEIRNPIHAIGLLIREMDYETEVEMEKGFNPAQPLNIRMNLTQLYGSNTAGYIVCRGV
HKIASTRFLICRDLLILQQLLMRLGDAVIWGTGQLFQAQQDLLHRTAPLLLSYYLIKWGS
ECLATDVPLDTLESNLQHLSVLELTDSGALMANRFVSSPQTIVELFFQEVARKHIISHLF
SQPKAPLSQTGLNWPEMITAITSYLLQLLWPSNPGCLFLECLMGNCQYVQLQDYIQLLHP
WCQVNVGSCRFMLGRCYLVTGEGQKALECFCQAASEVGKEEFLDRLIRSEDGEIVSTPRL
QYYDKVLRLLDVIGLPELVIQLATSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQAYEA
LTQIPDSSRQLDCLRQLVVVLCERSQLQDLVEFPYVNLHNEVVGIIESRARAVDLMTHNY
YELLYAFHIYRHNYRKAGTVMFEYGMRLGREVRTLRGLEKQGNCYLAALNCLRLIRPEYA
WIVQPVSGAVYDRPGASPKRNHDGECTAAPTNRQIEILELEDLEKECSLARIRLTLAQHD
PSAVAVAGSSSAEEMVTLLVQAGLFDTAISLCQTFKLPLTPVFEGLAFKCIKLQFGGEAA
QAEAWAWLAANQLSSVITTKESSATDEAWRLLSTYLERYKVQNNLYHHCVINKLLSHGVP
LPNWLINSYKKVDAAELLRLYLNYDLLEEAVDLVSEYVDAVLGKGHQYFGIEFPLSATAP
MVWLPYSSIDQLLQALGENSANSHNIALSQKILDKLEDYQQKVDKATRDLLYRRTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7r5jR0	0.753	0.772	0.000	1399	0.974	1.000	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
2	AFDB:Q12769	1.000	1.000	0.000	1436	1.000	1.000	Q12769.pdb.gz	NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3
3	AFDB:Q9VKJ3	0.666	0.677	1.915E-75	1411	0.274	0.279	Q9VKJ3.pdb.gz	NU160_DROME Nuclear pore complex protein Nup160 homolog OS=Drosophila melanogaster OX=7227 GN=Nup160 PE=1 SV=1
4	PDB:5a9q1	0.550	0.744	1.974E-72	1009	0.684	0.973	5a9q1.pdb.gz
5	PDB:7peqAJ	0.534	0.730	6.332E-65	996	0.674	0.972	7peqAJ.pdb.gz
6	AFDB:Q9C811	0.520	0.503	2.524E-40	1495	0.184	0.177	Q9C811.pdb.gz	NU160_ARATH Nuclear pore complex protein NUP160 OS=Arabidopsis thaliana OX=3702 GN=NUP160 PE=1 SV=2
7	AFDB:G0S0E7	0.516	0.574	2.496E-34	1262	0.146	0.166	G0S0E7.pdb.gz	NU120_CHATD Nucleoporin NUP120 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP120 PE=1 SV=1
8	AFDB:O43044	0.534	0.653	9.789E-29	1136	0.127	0.161	O43044.pdb.gz	NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup120 PE=1 SV=1
9	PDB:4xmmE	0.374	0.535	2.137E-17	896	0.088	0.141	4xmmE.pdb.gz
10	PDB:4fhnD	0.433	0.600	8.035E-16	977	0.110	0.162	4fhnD.pdb.gz
11	PDB:4fhnB	0.438	0.585	1.163E-15	1022	0.113	0.159	4fhnB.pdb.gz
12	PDB:7n84a	0.394	0.526	1.367E-12	1006	0.095	0.135	7n84a.pdb.gz
13	AFDB:Q9UTH0	0.188	0.224	2.922E-12	1162	0.106	0.131	Q9UTH0.pdb.gz	NU132_SCHPO Nucleoporin nup132 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup132 PE=1 SV=1
14	AFDB:Q38CC3	0.088	0.077	2.139E-10	1747	0.112	0.092	Q38CC3.pdb.gz	Q38CC3_TRYB2 Intraflagellar transport protein 172 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6920 PE=4 SV=1
15	PDB:7r5jK0	0.169	0.212	1.239E-9	1086	0.098	0.130	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	AFDB:X1WE68	0.193	0.134	1.763E-9	2527	0.105	0.060	X1WE68.pdb.gz
17	AFDB:Q22830	0.085	0.075	2.045E-9	1737	0.114	0.094	Q22830.pdb.gz	OSM1_CAEEL Intraflagellar transport protein osm-1 OS=Caenorhabditis elegans OX=6239 GN=osm-1 PE=1 SV=4
18	PDB:7r5jD4	0.179	0.194	4.361E-9	1312	0.118	0.130	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:7r5jT0	0.161	0.215	5.248E-9	1004	0.093	0.132	7r5jT0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	AFDB:Q5RHH4	0.090	0.078	5.353E-9	1745	0.112	0.092	Q5RHH4.pdb.gz	IF172_DANRE Intraflagellar transport protein 172 homolog OS=Danio rerio OX=7955 GN=ift172 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12769	0.0	2981	1436	1.000	1.000	NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3
2	Q9Z0W3	0.0	2729	1402	0.905	0.927	NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus OX=10090 GN=Nup160 PE=1 SV=2
3	Q9VKJ3	3.48e-160	522	1411	0.283	0.288	NU160_DROME Nuclear pore complex protein Nup160 homolog OS=Drosophila melanogaster OX=7227 GN=Nup160 PE=1 SV=1
4	Q9C811	2.39e-31	136	1495	0.095	0.091	NU160_ARATH Nuclear pore complex protein NUP160 OS=Arabidopsis thaliana OX=3702 GN=NUP160 PE=1 SV=2
5	G0S0E7	3.59e-15	84.0	1262	0.075	0.085	NU120_CHATD Nucleoporin NUP120 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP120 PE=1 SV=1
6	P91350	0.004	44.3	1522	0.033	0.032	P91350_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-6 PE=1 SV=2
7	J3KT66	0.17	35.4	93	0.012	0.183	J3KT66_HUMAN Phosphoinositide-3-kinase regulatory subunit 5 (Fragment) OS=Homo sapiens OX=9606 GN=PIK3R5 PE=1 SV=1
8	Q5KUG0	0.71	37.0	1086	0.019	0.025	ICMF_GEOKA Fused isobutyryl-CoA mutase OS=Geobacillus kaustophilus (strain HTA426) OX=235909 GN=icmF PE=1 SV=1
9	U2WQ53	0.71	37.0	1086	0.019	0.025	U2WQ53_GEOKU Fused isobutyryl-CoA mutase OS=Geobacillus kaustophilus GBlys OX=1337888 GN=icmF PE=3 SV=1
10	J3KSW1	0.88	36.6	879	0.012	0.019	J3KSW1_HUMAN Phosphoinositide-3-kinase regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=1 SV=1
11	L7RT34	0.88	36.6	880	0.012	0.019	L7RT34_HUMAN Phosphoinositide-3-kinase, regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=4 SV=1
12	Q8WYR1	0.88	36.6	880	0.012	0.019	PI3R5_HUMAN Phosphoinositide 3-kinase regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=1 SV=1
13	Q5SW28	3.4	34.7	871	0.011	0.018	PI3R5_MOUSE Phosphoinositide 3-kinase regulatory subunit 5 OS=Mus musculus OX=10090 GN=Pik3r5 PE=1 SV=1
14	Q8IWF2	3.6	34.7	684	0.018	0.038	FXRD2_HUMAN FAD-dependent oxidoreductase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FOXRED2 PE=1 SV=1
15	O02696	5.5	33.9	877	0.011	0.018	PI3R5_PIG Phosphoinositide 3-kinase regulatory subunit 5 OS=Sus scrofa OX=9823 GN=PIK3R5 PE=1 SV=1
16	P48596	5.8	33.5	324	0.019	0.083	GCH1_DROME GTP cyclohydrolase 1 OS=Drosophila melanogaster OX=7227 GN=Pu PE=1 SV=3
17	Q7KQL7	6.9	33.5	820	0.021	0.037	Q7KQL7_PLAF7 Acyl-CoA synthetase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1479000 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11715 Nup160	5.2e-119	410.1	Nucleoporin Nup120/160

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367721

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229179	0.999	Nuclear pore complex protein Nup107
2	9606.ENSP00000245544	0.999	Nuclear pore complex protein Nup85
3	9606.ENSP00000261396	0.999	Nuclear pore complex protein Nup133
4	9606.ENSP00000316032	0.999	Nuclear pore complex protein Nup98-Nup96
5	9606.ENSP00000342262	0.999	Nucleoporin Nup43
6	9606.ENSP00000373312	0.999	Protein SEC13 homolog
7	9606.ENSP00000382779	0.999	Nucleoporin SEH1
8	9606.ENSP00000448054	0.999	Nucleoporin Nup37
9	9606.ENSP00000355465	0.997	Protein ELYS
10	9606.ENSP00000231498	0.995	Nuclear pore complex protein Nup155
11	9606.ENSP00000295119	0.988	Nucleoporin NUP53
12	9606.ENSP00000444029	0.986	Nuclear pore complex protein Nup153
13	9606.ENSP00000254508	0.972	Nuclear pore membrane glycoprotein 210
14	9606.ENSP00000285968	0.964	Nuclear pore complex protein Nup205
15	9606.ENSP00000310668	0.962	Nuclear pore complex protein Nup93
16	9606.ENSP00000308622	0.960	Nucleoporin GLE1
17	9606.ENSP00000446215	0.944	GTP-binding nuclear protein Ran
18	9606.ENSP00000471191	0.943	Nuclear pore glycoprotein p62
19	9606.ENSP00000292476	0.941	Cleavage and polyadenylation specificity factor subunit 4
20	9606.ENSP00000451291	0.941	Heterogeneous nuclear ribonucleoproteins C1/C2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017056	1.000	structural constituent of nuclear pore
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0071704	0.977	organic substance metabolic process
GO:0010467	0.965	gene expression
GO:0051168	0.965	nuclear export
GO:0006406	0.961	mRNA export from nucleus
GO:0032502	0.678	developmental process
GO:0032501	0.642	multicellular organismal process
GO:0048856	0.642	anatomical structure development
GO:0007275	0.576	multicellular organism development
GO:0072001	0.556	renal system development
GO:0065007	0.340	biological regulation
GO:0050794	0.330	regulation of cellular process
GO:0001822	0.305	kidney development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005643	1.000	nuclear pore
GO:0005829	0.990	cytosol
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0031981	0.948	nuclear lumen
GO:0005694	0.909	chromosome
GO:0000775	0.665	chromosome, centromeric region
GO:0000793	0.659	condensed chromosome
GO:0000776	0.652	kinetochore
GO:0005654	0.606	nucleoplasm
GO:0031080	0.605	nuclear pore outer ring
GO:0016020	0.378	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]