StarFunc result for job id Q12770

User Input

>input (1279 residues)
MTLTERLREKISRAFYNHGLLCASYPIPIILFTGFCILACCYPLLKLPLPGTGPVEFTTP
VKDYSPPPVDSDRKQGEPTEQPEWYVGAPVAYVQQIFVKSSVFPWHKNLLAVDVFRSPLS
RAFQLVEEIRNHVLRDSSGIRSLEELCLQVTDLLPGLRKLRNLLPEHGCLLLSPGNFWQN
DWERFHADPDIIGTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSLYTRKRMVSYTITLVF
QHYHAKFLGSLRARLMLLHPSPNCSLRAESLVHVHFKEEIGVAELIPLVTTYIILFAYIY
FSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLEN
VLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNMATELGIILIGYFTLVPAIQEFCLF
AVVGLVSDFFLQMLFFTTVLSIDIRRMELADLNKRLPPEACLPSAKPVGQPTRYERQLAV
RPSTPHTITLQPSSFRNLRLPKRLRVVYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLR
NYLAAQVTEQSPLGEGALAPMPVPSGMLPPSHPDPAFSIFPPDAPKLPENQTSPGESPER
GGPAEVVHDSPVPEVTWGPEDEELWRKLSFRHWPTLFSYYNITLAKRYISLLPVIPVTLR
LNPREALEGRHPQDGRSAWPPPGPIPAGHWEAGPKGPGGVQAHGDVTLYKVAALGLATGI
VLVLLLLCLYRVLCPRNYGQLGGGPGRRRRGELPCDDYGYAPPETEIVPLVLRGHLMDIE
CLASDGMLLVSCCLAGHVCVWDAQTGDCLTRIPRPGRQRRDSGVGSGLEAQESWERLSDG
GKAGPEEPGDSPPLRHRPRGPPPPSLFGDQPDLTCLIDTNFSAQPRSSQPTQPEPRHRAV
CGRSRDSPGYDFSCLVQRVYQEEGLAAVCTPALRPPSPGPVLSQAPEDEGGSPEKGSPSL
AWAPSAEGSIWSLELQGNLIVVGRSSGRLEVWDAIEGVLCCSSEEVSSGITALVFLDKRI
VAARLNGSLDFFSLETHTALSPLQFRGTPGRGSSPASPVYSSSDTVACHLTHTVPCAHQK
PITALKAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTVYIDQTMVLASGGQDG
AICLWDVLTGSRVSHVFAHRGDVTSLTCTTSCVISSGLDDLISIWDRSTGIKFYSIQQDL
GCGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVC
NFGSELSLVYVPSVLEKLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12770	1.000	1.000	0.000	1279	1.000	1.000	Q12770.pdb.gz	SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens OX=9606 GN=SCAP PE=1 SV=4
2	AFDB:P42527	0.190	0.210	8.484E-18	1146	0.048	0.053	P42527.pdb.gz	MHCKA_DICDI Myosin heavy chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mhkA PE=1 SV=2
3	AFDB:Q9H2Y7	0.186	0.129	1.379E-17	1883	0.100	0.068	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
4	PDB:6ttuT	0.186	0.552	2.213E-16	394	0.041	0.135	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
5	AFDB:Q07141	0.184	0.302	5.276E-16	748	0.082	0.140	Q07141.pdb.gz	TLE4_RAT Transducin-like enhancer protein 4 OS=Rattus norvegicus OX=10116 GN=Tle4 PE=1 SV=2
6	PDB:5mzhB	0.198	0.591	1.971E-15	415	0.041	0.128	5mzhB.pdb.gz
7	PDB:6bk8D	0.184	0.577	3.530E-15	359	0.035	0.125	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
8	AFDB:F4JUD2	0.177	0.229	6.929E-15	969	0.082	0.108	F4JUD2.pdb.gz	F4JUD2_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=1
9	PDB:5yzgs	0.183	0.555	1.249E-14	374	0.038	0.131	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
10	PDB:3jcmB	0.180	0.487	1.517E-14	429	0.041	0.121	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
11	PDB:7ajuUL	0.187	0.296	2.466E-14	779	0.041	0.067	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:7mgmC	0.178	0.568	3.818E-14	348	0.044	0.161	7mgmC.pdb.gz	Structural basis for cytoplasmic dynein-1 regulation by Lis1.
13	PDB:7pzyh	0.187	0.665	8.307E-14	311	0.045	0.186	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
14	PDB:7zgrD	0.184	0.538	8.307E-14	395	0.032	0.104	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
15	PDB:5jcsq	0.168	0.377	8.721E-14	488	0.042	0.111	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
16	AFDB:Q389F7	0.186	0.213	1.117E-11	1105	0.039	0.045	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
17	AFDB:Q9Y6C5	0.174	0.184	1.907E-11	1203	0.080	0.085	Q9Y6C5.pdb.gz	PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens OX=9606 GN=PTCH2 PE=1 SV=2
18	AFDB:Q9W002	0.166	0.143	1.208E-10	1504	0.073	0.062	Q9W002.pdb.gz	Q9W002_DROME Misshapen, isoform A OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=3
19	AFDB:A0A0B4LFW8	0.147	0.147	1.440E-9	1277	0.081	0.081	A0A0B4LFW8.pdb.gz	A0A0B4LFW8_DROME Thin, isoform E OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
20	AFDB:Q9VC96	0.194	0.113	1.587E-9	2232	0.048	0.027	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRU4	0.0	2272	1276	0.925	0.927	SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus OX=10116 GN=Scap PE=2 SV=1
2	E9QEH6	0.0	1680	1245	0.696	0.715	E9QEH6_DANRE Sterol regulatory element-binding protein cleavage-activating protein OS=Danio rerio OX=7955 GN=scap PE=1 SV=1
3	P97260	0.0	2313	1276	0.920	0.922	SCAP_CRIGR Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus OX=10029 GN=SCAP PE=1 SV=1
4	Q12770	0.0	2597	1279	1.000	1.000	SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens OX=9606 GN=SCAP PE=1 SV=4
5	Q6GQT6	0.0	2261	1276	0.919	0.922	SCAP_MOUSE Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus OX=10090 GN=Scap PE=1 SV=1
6	F1QNG7	1.25e-19	98.2	1276	0.093	0.093	F1QNG7_DANRE Niemann-Pick C1 protein isoform X2 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
7	A0A2R8Q2J0	1.36e-19	98.2	1277	0.093	0.093	A0A2R8Q2J0_DANRE Niemann-Pick C1 protein isoform X1 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
8	A0A0R4IZV0	1.39e-19	97.8	1271	0.093	0.094	A0A0R4IZV0_DANRE Niemann-Pick C1 protein precursor OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=2
9	B7ZDC8	3.09e-18	92.4	544	0.052	0.121	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
10	Q969H0	1.13e-17	91.3	707	0.052	0.093	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
11	Q8VBV4	1.66e-17	90.5	710	0.052	0.093	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
12	O14170	2.95e-15	83.2	703	0.062	0.112	POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop2 PE=1 SV=1
13	Q7TMD4	3.75e-15	83.6	1277	0.091	0.091	Q7TMD4_MOUSE Niemann Pick type C1 OS=Mus musculus OX=10090 GN=Npc1 PE=2 SV=1
14	O35604	3.88e-15	83.6	1277	0.091	0.091	NPC1_MOUSE NPC intracellular cholesterol transporter 1 OS=Mus musculus OX=10090 GN=Npc1 PE=1 SV=2
15	F4I9G5	3.92e-15	83.6	1260	0.049	0.050	F4I9G5_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1 PE=1 SV=2
16	G3V7K5	4.75e-15	83.2	1278	0.092	0.092	G3V7K5_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=3 SV=1
17	A0A8I6GB30	5.42e-15	83.2	1265	0.092	0.093	A0A8I6GB30_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=1 SV=1
18	A0A8I6AL97	6.41e-15	82.8	1259	0.091	0.093	A0A8I6AL97_RAT NPC intracellular cholesterol transporter 1 OS=Rattus norvegicus OX=10116 GN=Npc1 PE=1 SV=1
19	B4DIP7	1.56e-14	81.3	776	0.063	0.104	B4DIP7_HUMAN cDNA FLJ57114, highly similar to Niemann-Pick C1 protein OS=Homo sapiens OX=9606 PE=2 SV=1
20	O43043	1.96e-14	81.3	1086	0.038	0.044	SCAP_SCHPO Sterol regulatory element-binding protein cleavage-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=scp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.26	22.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF02460 Patched	1.5e-16	71.4	Patched family
3	PF12349 Sterol-sensing	2.7e-45	165.4	Sterol-sensing domain of SREBP cleavage-activation
4	PF00400 WD40	5.6e-06	38.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265565

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344741	0.999	Insulin-induced gene 1 protein
2	9606.ENSP00000348069	0.999	Sterol regulatory element-binding protein 1
3	9606.ENSP00000354476	0.999	Sterol regulatory element-binding protein 2
4	9606.ENSP00000245787	0.991	Insulin-induced gene 2 protein
5	9606.ENSP00000344223	0.974	Membrane-bound transcription factor site-1 protease
6	9606.ENSP00000428564	0.886	Protein transport protein Sec24B
7	9606.ENSP00000368798	0.844	Membrane-bound transcription factor site-2 protease
8	9606.ENSP00000306881	0.720	Protein transport protein Sec23A
9	9606.ENSP00000276461	0.715	Erlin-2
10	9606.ENSP00000380432	0.712	Insulin
11	9606.ENSP00000254181	0.666	Ubiquitin specific peptidase 29
12	9606.ENSP00000304051	0.659	E3 ubiquitin-protein ligase RNF139
13	9606.ENSP00000385432	0.656	GTP-binding protein SAR1b
14	9606.ENSP00000356919	0.630	Cyclic AMP-dependent transcription factor ATF-6 alpha
15	9606.ENSP00000261942	0.621	FAS-associated factor 2
16	9606.ENSP00000381823	0.619	Protein transport protein Sec24A
17	9606.ENSP00000304236	0.618	Monocyte differentiation antigen CD14
18	9606.ENSP00000343405	0.615	Protein transport protein Sec24C
19	9606.ENSP00000280551	0.608	Protein transport protein Sec24D
20	9606.ENSP00000364349	0.604	Cyclic AMP-dependent transcription factor ATF-6 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.793	organic cyclic compound binding
GO:0008289	0.392	lipid binding
GO:1901363	0.326	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0009987	0.991	cellular process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0006629	0.977	lipid metabolic process
GO:0050896	0.955	response to stimulus
GO:0019218	0.933	regulation of steroid metabolic process
GO:0062012	0.931	regulation of small molecule metabolic process
GO:0006984	0.880	ER-nucleus signaling pathway
GO:0006950	0.877	response to stress
GO:0046890	0.861	regulation of lipid biosynthetic process
GO:0051179	0.857	localization
GO:1901615	0.779	organic hydroxy compound metabolic process
GO:0090181	0.778	regulation of cholesterol metabolic process
GO:0050810	0.778	regulation of steroid biosynthetic process
GO:0031323	0.761	regulation of cellular metabolic process
GO:1901360	0.759	organic cyclic compound metabolic process
GO:0048518	0.754	positive regulation of biological process
GO:1902930	0.735	regulation of alcohol biosynthetic process
GO:0008202	0.721	steroid metabolic process
GO:0033036	0.702	macromolecule localization
GO:0009893	0.675	positive regulation of metabolic process
GO:0042221	0.669	response to chemical
GO:0007568	0.667	aging
GO:0046889	0.660	positive regulation of lipid biosynthetic process
GO:0010033	0.572	response to organic substance
GO:0044237	0.557	cellular metabolic process
GO:0062013	0.547	positive regulation of small molecule metabolic process
GO:0016125	0.518	sterol metabolic process
GO:0033554	0.485	cellular response to stress
GO:0031326	0.472	regulation of cellular biosynthetic process
GO:0044281	0.467	small molecule metabolic process
GO:0008203	0.432	cholesterol metabolic process
GO:0048522	0.428	positive regulation of cellular process
GO:0006807	0.350	nitrogen compound metabolic process
GO:0006810	0.324	transport
GO:0051641	0.317	cellular localization
GO:0009058	0.315	biosynthetic process
GO:1901576	0.314	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.998	endoplasmic reticulum membrane
GO:0032991	0.996	protein-containing complex
GO:0098588	0.933	bounding membrane of organelle
GO:0005794	0.924	Golgi apparatus
GO:0000139	0.658	Golgi membrane
GO:0031982	0.598	vesicle
GO:0031410	0.322	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]