StarFunc result for job id Q12772

User Input

>input (1141 residues)
MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGS
GSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTS
VPTTPRATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQV
LQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVP
VLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILT
TMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGT
DAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLK
IEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRS
RILLCVLTFLCLSFNPLTSLLQWGGAHDSDQHPHSGSGRSVLSFESGSGGWFDWMMPTLL
LWLVNGVIVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAGNLQTC
LAVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQCRRATPATEAGFEDEAK
TSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKIPPSTLVEIHLTA
AMGLKTRCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSVKSA
AKESLYCAQRNPADPIAQVHQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEY
LKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
KVERIPKALEVTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASGHLWSSLNVSG
ATSDPALNHVVQLLTCDLLLSLRTALWQKQASASQAVGETYHASGAELAGFQRDLGSLRR
LAHSFRPAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTQSTKHGEVDAWPGQRER
ATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAA
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1Q0	0.627	0.627	0.000	1141	1.000	1.000	A0A024R1Q0.pdb.gz
2	AFDB:R4GLV5	0.550	0.561	3.308E-62	1116	0.449	0.459	R4GLV5.pdb.gz
3	AFDB:A6XLD8	0.555	0.573	1.455E-61	1105	0.465	0.481	A6XLD8.pdb.gz	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1
4	AFDB:P56720	0.552	0.555	7.197E-61	1134	0.450	0.453	P56720.pdb.gz	SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Srebf1 PE=1 SV=3
5	AFDB:A0A087X1T2	0.089	0.145	3.802E-39	654	0.488	0.852	A0A087X1T2.pdb.gz	A0A087X1T2_HUMAN Sterol regulatory element binding transcription factor 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=1
6	AFDB:Q14669	0.107	0.075	1.540E-4	1992	0.110	0.063	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
7	AFDB:G5E870	0.095	0.070	2.365E-4	2025	0.111	0.063	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
8	AFDB:A0A0R4IZ84	0.082	0.064	2.658E-4	1544	0.100	0.074	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
9	PDB:6bq1B	0.155	0.209	7.457E-4	728	0.068	0.107	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
10	AFDB:Q7Z5K2	0.107	0.104	9.624E-4	1190	0.120	0.115	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
11	PDB:7dhgC	0.147	0.282	1.828E-3	470	0.051	0.123	7dhgC.pdb.gz
12	PDB:5dseA	0.147	0.243	2.055E-3	537	0.060	0.128	5dseA.pdb.gz
13	AFDB:P25339	0.091	0.108	2.652E-3	888	0.094	0.120	P25339.pdb.gz	PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF4 PE=1 SV=2
14	PDB:4gyoB	0.108	0.236	5.888E-3	359	0.045	0.142	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
15	PDB:4bujB	0.117	0.108	7.155E-3	1367	0.071	0.059	4bujB.pdb.gz
16	PDB:6exnT	0.084	0.121	9.040E-3	594	0.060	0.114	6exnT.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
17	PDB:6tedQ	0.167	0.194	1.016E-2	890	0.061	0.079	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
18	PDB:7dkhI	0.122	0.140	1.099E-2	914	0.067	0.083	7dkhI.pdb.gz
19	PDB:7qe7J	0.134	0.219	1.284E-2	510	0.054	0.122	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
20	PDB:3q15A	0.148	0.325	1.388E-2	365	0.047	0.148	3q15A.pdb.gz	Structural basis of response regulator dephosphorylation by Rap phosphatases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X1T2	0.0	1129	654	0.495	0.864	A0A087X1T2_HUMAN Sterol regulatory element binding transcription factor 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=1
2	A3KNA7	0.0	850	1099	0.503	0.522	SRBP2_DANRE Sterol regulatory element-binding protein 2 OS=Danio rerio OX=7955 GN=srebf2 PE=1 SV=1
3	A6XLD8	0.0	866	1105	0.472	0.487	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1
4	P36956	0.0	784	1147	0.461	0.459	SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2
5	P56720	0.0	771	1134	0.447	0.450	SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Srebf1 PE=1 SV=3
6	Q12772	0.0	2333	1141	1.000	1.000	SRBP2_HUMAN Sterol regulatory element-binding protein 2 OS=Homo sapiens OX=9606 GN=SREBF2 PE=1 SV=2
7	Q3T1I5	0.0	1979	1133	0.918	0.924	SRBP2_RAT Sterol regulatory element-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Srebf2 PE=2 SV=1
8	Q3U1N2	0.0	2010	1130	0.917	0.926	SRBP2_MOUSE Sterol regulatory element-binding protein 2 OS=Mus musculus OX=10090 GN=Srebf2 PE=1 SV=2
9	Q60429	0.0	1992	1139	0.923	0.924	SRBP2_CRIGR Sterol regulatory element-binding protein 2 OS=Cricetulus griseus OX=10029 GN=SREBF2 PE=2 SV=1
10	Q90WR7	0.0	676	521	0.309	0.678	Q90WR7_CHICK Sterol regulatory element binding protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=SREBP-2 PE=2 SV=1
11	Q90ZM5	0.0	787	1115	0.449	0.459	Q90ZM5_CHICK Sterol regulatory element binding protein 1 OS=Gallus gallus OX=9031 PE=2 SV=1
12	Q98SH5	0.0	669	396	0.306	0.881	Q98SH5_CHICK Sterol regulatory element binding protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=SREBP2 PE=2 SV=1
13	Q9WTN3	0.0	746	1134	0.454	0.457	SRBP1_MOUSE Sterol regulatory element-binding protein 1 OS=Mus musculus OX=10090 GN=Srebf1 PE=1 SV=4
14	Q24146	3.41e-120	400	1113	0.254	0.261	Q24146_DROME HLH106 OS=Drosophila melanogaster OX=7227 GN=SREBP PE=2 SV=1
15	Q9VW37	1.36e-119	398	1113	0.254	0.261	Q9VW37_DROME LP12374p OS=Drosophila melanogaster OX=7227 GN=SREBP PE=1 SV=1
16	Q9XX00	7.15e-41	166	1113	0.162	0.166	SRBPH_CAEEL Sterol regulatory element binding protein sbp-1 OS=Caenorhabditis elegans OX=6239 GN=sbp-1 PE=2 SV=1
17	O43019	6.26e-10	65.9	793	0.032	0.045	SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sre2 PE=1 SV=1
18	A0A0S2Z4U5	5.57e-09	61.2	310	0.032	0.116	A0A0S2Z4U5_HUMAN Upstream transcription factor 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=USF1 PE=2 SV=1
19	P22415	5.57e-09	61.2	310	0.032	0.116	USF1_HUMAN Upstream stimulatory factor 1 OS=Homo sapiens OX=9606 GN=USF1 PE=1 SV=1
20	Q61069	7.17e-09	60.8	310	0.032	0.116	USF1_MOUSE Upstream stimulatory factor 1 OS=Mus musculus OX=10090 GN=Usf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05700 BCAS2	4.2e+02	12.0	Breast carcinoma amplified sequence 2 (BCAS2)
2	PF00010 HLH	8.5e-13	59.4	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354476

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265565	0.999	Sterol regulatory element-binding protein cleavage-activating protein
2	9606.ENSP00000344741	0.997	Insulin-induced gene 1 protein
3	9606.ENSP00000287936	0.992	3-hydroxy-3-methylglutaryl-coenzyme A reductase
4	9606.ENSP00000322706	0.983	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
5	9606.ENSP00000368798	0.983	Membrane-bound transcription factor site-2 protease
6	9606.ENSP00000245787	0.981	Insulin-induced gene 2 protein
7	9606.ENSP00000454071	0.979	Low-density lipoprotein receptor
8	9606.ENSP00000265896	0.972	Squalene monooxygenase
9	9606.ENSP00000480828	0.970	Squalene synthase
10	9606.ENSP00000344223	0.968	Membrane-bound transcription factor site-1 protease
11	9606.ENSP00000349078	0.966	Farnesyl pyrophosphate synthase
12	9606.ENSP00000003100	0.965	Lanosterol 14-alpha demethylase
13	9606.ENSP00000287820	0.964	Peroxisome proliferator-activated receptor gamma
14	9606.ENSP00000347717	0.964	7-dehydrocholesterol reductase
15	9606.ENSP00000380837	0.964	Lanosterol synthase
16	9606.ENSP00000282841	0.959	Geranylgeranyl pyrophosphate synthase
17	9606.ENSP00000370748	0.958	Isopentenyl-diphosphate Delta-isomerase 1
18	9606.ENSP00000443551	0.958	Mevalonate kinase
19	9606.ENSP00000269305	0.956	Cellular tumor antigen p53
20	9606.ENSP00000264027	0.954	Lathosterol oxidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.996	cis-regulatory region sequence-specific DNA binding
GO:0005515	0.995	protein binding
GO:0000978	0.992	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003682	0.922	chromatin binding
GO:0001228	0.868	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0044877	0.784	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009891	0.998	positive regulation of biosynthetic process
GO:0080090	0.997	regulation of primary metabolic process
GO:0048522	0.996	positive regulation of cellular process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0006355	0.993	regulation of DNA-templated transcription
GO:0031328	0.986	positive regulation of cellular biosynthetic process
GO:0009987	0.985	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0010557	0.985	positive regulation of macromolecule biosynthetic process
GO:0044238	0.982	primary metabolic process
GO:0045935	0.972	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.964	regulation of transcription by RNA polymerase II
GO:0045893	0.963	positive regulation of DNA-templated transcription
GO:0045944	0.893	positive regulation of transcription by RNA polymerase II
GO:0050896	0.874	response to stimulus
GO:0006629	0.711	lipid metabolic process
GO:0042221	0.689	response to chemical
GO:0044237	0.641	cellular metabolic process
GO:0006807	0.500	nitrogen compound metabolic process
GO:0048519	0.464	negative regulation of biological process
GO:0051716	0.458	cellular response to stimulus
GO:1901360	0.447	organic cyclic compound metabolic process
GO:1901576	0.432	organic substance biosynthetic process
GO:0048523	0.427	negative regulation of cellular process
GO:0010033	0.396	response to organic substance
GO:0032501	0.390	multicellular organismal process
GO:0008610	0.319	lipid biosynthetic process
GO:0007154	0.309	cell communication
GO:0006950	0.304	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.998	membrane
GO:0012505	0.997	endomembrane system
GO:0005654	0.995	nucleoplasm
GO:0032991	0.978	protein-containing complex
GO:0005783	0.978	endoplasmic reticulum
GO:0031090	0.910	organelle membrane
GO:0098827	0.870	endoplasmic reticulum subcompartment
GO:0005789	0.812	endoplasmic reticulum membrane
GO:0005829	0.675	cytosol
GO:0098796	0.368	membrane protein complex
GO:0098588	0.311	bounding membrane of organelle
GO:0071944	0.304	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]