StarFunc result for job id Q12774

User Input

>input (1597 residues)
MEAEEAQRGASPPISAIEEFSIIPEAPMRSSQVSALGLEAQEDEDPSYKWREEHRLSATQ
QSELRDVCDYAIETMPSFPKEGSADVEPNQESLVAEACDTPEHWEAVPQSLAGRQARTLA
PPELWACPIQSEHLDMAPFSSDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDNSGQT
RYYSPCEEHPAETNQNEGSESGTIRQGEELPPEELQESQGLLHPQEVQVLEEQGQQEAGF
RGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGL
NDGEWEQEDMERKAQGQGGPEQGEERKRELQVPEENRADSQDEKSQTFLGKSEEVTGKQE
DHGIKEKGVPVSGQEAKEPESWDGGRLGAVGRARSREEENEHHGPSMPALIAPEDSPHCD
LFPGASYLMTQIPGTQTESRAEELSPAALSPSLEPIRCSHQPISLLGSFLTEESPDKEID
QNSQQEESRLRKGTVSSQGTEVVFASASVTPPRTPDSAPPSPAEAYPITPASVSARPPVA
FPRRETSCAARAPETASAPLSMDDPSPCGTSEMCPAALYGFPSTGTSPPRPPANSTGTVQ
HLRSDSFPGSHRTEQTPDLVGMLLSYSHSELPQRPPKPAIYSSVTPRRDRRSGRDYSTVS
ASPTALSTLKQDSQESISNLERPSSPPSIQPWVSPHNPAFATESPAYGSSPSFVSMEDVR
IHEPLPPPPPQRRDTHPSVVETDGHARVVVPTLKQHSHPPPLALGSGLHAPHKGPLPQAS
DPAVARQHRPLPSTPDSSHHAQATPRWRYNKPLPPTPDLPQPHLPPISAPGSSRIYRPLP
PLPIIDPPTEPPPLPPKSRGRSRSTRGGHMNSGGHAKTRPACQDWTVPLPASAGRTSWPP
ATARSTESFTSTSRSKSEVSPGMAFSNMTNFLCPSSPTTPWTPELQGPTSKDEAGVSEHP
EAPAREPLRRTTPQQGASGPGRSPVGQARQPEKPSHLHLEKASSWPHRRDSGRPPGDSSG
QAVAPSEGANKHKGWSRQGLRRPSILPEGSSDSRGPAVEKHPGPSDTVVFREKKPKEVMG
GFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLSETPGPSSPRQPRKALVSSESY
LQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEVKFELIVSEASYLRSLNIAVDHF
QLSTSLRATLSNQEHQWLFSRLQDVRDVSATFLSDLEENFENNIFSFQVCDVVLNHAPDF
RRVYLPYVTNQTYQERTFQSLMNSNSNFREVLEKLESDPVCQRLSLKSFLILPFQRITRL
KLLLQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRRTEELIYLSQKIEFECK
IFPLISQSRWLVKSGELTALEFSASPGLRRKLNTRPVHLHLFNDCLLLSRPREGSRFLVF
DHAPFSSIRGEKCEMKLHGPHKNLFRLFLRQNTQGAQAEFLFRTETQSEKLRWISALAMP
REELDLLECYNSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGERGW
FPVQQVEFISNPEVRAQNLKEAHRVKTAKLQLVEQQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q7D5	0.348	0.352	0.000	1581	0.646	0.652	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
2	AFDB:Q12774	1.000	1.000	0.000	1597	1.000	1.000	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
3	AFDB:Q9VW85	0.198	0.190	3.508E-17	1661	0.165	0.158	Q9VW85.pdb.gz	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
4	AFDB:Q96PE2	0.174	0.139	5.932E-16	2063	0.156	0.121	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
5	AFDB:Q6ZNL6	0.115	0.125	2.382E-15	1462	0.135	0.148	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
6	PDB:4mt6A	0.156	0.503	5.108E-15	389	0.036	0.149	4mt6A.pdb.gz
7	AFDB:A1ZAN6	0.189	0.123	5.380E-15	2559	0.156	0.097	A1ZAN6.pdb.gz	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
8	AFDB:M9PHU0	0.191	0.138	1.871E-14	2263	0.143	0.101	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
9	PDB:7rx9A	0.111	0.393	6.797E-14	432	0.042	0.155	7rx9A.pdb.gz
10	AFDB:Q9VZ85	0.167	0.136	1.147E-9	1984	0.150	0.121	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
11	PDB:4gouA	0.108	0.321	1.317E-8	507	0.032	0.101	4gouA.pdb.gz
12	AFDB:P91620	0.134	0.111	9.437E-8	2061	0.147	0.114	P91620.pdb.gz	SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
13	AFDB:Q9NZ56	0.048	0.046	3.110E-4	1722	0.160	0.148	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
14	PDB:5yqrA	0.064	0.293	5.507E-4	268	0.021	0.127	5yqrA.pdb.gz
15	PDB:6u3eA	0.069	0.206	6.998E-4	397	0.034	0.139	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:1griA	0.046	0.266	1.244E-3	211	0.017	0.128	1griA.pdb.gz
17	PDB:2dybA	0.036	0.189	1.305E-3	298	0.015	0.081	2dybA.pdb.gz
18	PDB:6hhgA	0.052	0.194	1.581E-3	386	0.019	0.078	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
19	PDB:5kcvA	0.049	0.201	1.740E-3	353	0.016	0.074	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
20	PDB:3ehqA	0.042	0.329	2.433E-3	182	0.014	0.121	3ehqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A090N7S2	0.0	1074	519	0.325	1.000	A0A090N7S2_HUMAN Rho guanine nucleotide exchange factor (GEF) 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=4 SV=1
2	E9Q7D5	0.0	1839	1581	0.656	0.662	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
3	H0Y895	0.0	1568	797	0.492	0.985	H0Y895_HUMAN Rho guanine nucleotide exchange factor 5 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=1
4	Q12774	0.0	3244	1597	1.000	1.000	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
5	Q8IW93	2.18e-154	493	802	0.172	0.342	ARHGJ_HUMAN Rho guanine nucleotide exchange factor 19 OS=Homo sapiens OX=9606 GN=ARHGEF19 PE=1 SV=1
6	E7EY47	3.06e-154	497	958	0.169	0.282	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
7	Q8BWA8	5.08e-154	492	802	0.170	0.338	ARHGJ_MOUSE Rho guanine nucleotide exchange factor 19 OS=Mus musculus OX=10090 GN=Arhgef19 PE=1 SV=1
8	Q5I1Y9	2.38e-115	377	533	0.138	0.413	Q5I1Y9_CHICK Ephexin1 OS=Gallus gallus OX=9031 PE=2 SV=1
9	Q5BKC9	1.60e-113	378	701	0.140	0.318	NGEF_RAT Ephexin-1 OS=Rattus norvegicus OX=10116 GN=Ngef PE=1 SV=2
10	Q8N5V2	3.21e-111	372	710	0.138	0.310	NGEF_HUMAN Ephexin-1 OS=Homo sapiens OX=9606 GN=NGEF PE=1 SV=2
11	Q8CHT1	4.49e-110	368	710	0.125	0.280	NGEF_MOUSE Ephexin-1 OS=Mus musculus OX=10090 GN=Ngef PE=1 SV=1
12	Q5VV41	2.27e-84	295	709	0.114	0.257	ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1
13	Q96DR7	3.10e-81	290	871	0.103	0.188	ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens OX=9606 GN=ARHGEF26 PE=1 SV=4
14	D3YYY8	8.21e-81	288	869	0.101	0.185	D3YYY8_MOUSE Rho guanine nucleotide exchange factor (GEF) 26 OS=Mus musculus OX=10090 GN=Arhgef26 PE=1 SV=1
15	Q9Y150	2.45e-64	241	1051	0.101	0.153	Q9Y150_DROME BcDNA.GH03693 OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=1
16	A0A0G2JTU0	7.96e-64	237	850	0.118	0.221	A0A0G2JTU0_RAT Rho guanine nucleotide exchange factor 15 OS=Rattus norvegicus OX=10116 GN=Arhgef15 PE=1 SV=1
17	O94989	1.03e-63	236	841	0.113	0.214	ARHGF_HUMAN Rho guanine nucleotide exchange factor 15 OS=Homo sapiens OX=9606 GN=ARHGEF15 PE=1 SV=4
18	Q5FWH6	1.87e-63	236	849	0.118	0.221	ARHGF_MOUSE Rho guanine nucleotide exchange factor 15 OS=Mus musculus OX=10090 GN=Arhgef15 PE=1 SV=1
19	Q9VVC6	5.27e-63	240	2029	0.101	0.080	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3
20	D3ZPJ8	2.16e-52	199	670	0.084	0.200	D3ZPJ8_RAT Rho guanine nucleotide exchange factor 15 OS=Rattus norvegicus OX=10116 GN=Arhgef15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15441 ARHGEF5_35	7e-223	752.6	RhoGEF 5/35 N-terminal disordered region
2	PF00169 PH	0.078	24.9	PH domain
3	PF00621 RhoGEF	6.4e-33	126.0	RhoGEF domain
4	PF00018 SH3_1	3.2e-06	37.9	SH3 domain
5	PF07653 SH3_2	0.00024	32.1	Variant SH3 domain
6	PF14604 SH3_9	1.7e-07	42.3	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000056217

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.965	Transforming protein RhoA
2	9606.ENSP00000371897	0.935	Rho GTPase-activating protein 5
3	9606.ENSP00000275364	0.917	Guanine nucleotide-binding protein subunit alpha-12
4	9606.ENSP00000348461	0.917	Ras-related C3 botulinum toxin substrate 1
5	9606.ENSP00000286548	0.907	Guanine nucleotide-binding protein G(q) subunit alpha
6	9606.ENSP00000248572	0.906	Guanine nucleotide-binding protein G(T) subunit gamma-T1
7	9606.ENSP00000400717	0.906	Guanine nucleotide-binding protein subunit alpha-13
8	9606.ENSP00000481878	0.901	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
9	9606.ENSP00000379401	0.677	Odontogenic ameloblast-associated protein
10	9606.ENSP00000250617	0.625	Rho guanine nucleotide exchange factor 6
11	9606.ENSP00000347710	0.584	Oligophrenin-1
12	9606.ENSP00000366826	0.562	Ankyrin repeat domain-containing protein 20A2
13	9606.ENSP00000373347	0.554	SLIT-ROBO Rho GTPase-activating protein 3
14	9606.ENSP00000339467	0.552	Rho-related GTP-binding protein RhoG
15	9606.ENSP00000264644	0.536	Rap guanine nucleotide exchange factor-like 1
16	9606.ENSP00000298694	0.535	Rho guanine nucleotide exchange factor 40
17	9606.ENSP00000387020	0.518	Rho guanine nucleotide exchange factor 33
18	9606.ENSP00000404232	0.507	EF-hand domain-containing family member C2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:1901363	0.929	heterocyclic compound binding
GO:0097159	0.929	organic cyclic compound binding
GO:1901265	0.912	nucleoside phosphate binding
GO:0043167	0.910	ion binding
GO:0097367	0.905	carbohydrate derivative binding
GO:0032553	0.904	ribonucleotide binding
GO:0035639	0.899	purine ribonucleoside triphosphate binding
GO:0017076	0.898	purine nucleotide binding
GO:0032555	0.894	purine ribonucleotide binding
GO:0019001	0.867	guanyl nucleotide binding
GO:0005525	0.860	GTP binding
GO:0019899	0.519	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0023051	0.979	regulation of signaling
GO:0010646	0.979	regulation of cell communication
GO:0048583	0.974	regulation of response to stimulus
GO:0048522	0.937	positive regulation of cellular process
GO:1902531	0.937	regulation of intracellular signal transduction
GO:0051056	0.896	regulation of small GTPase mediated signal transduction
GO:0065009	0.863	regulation of molecular function
GO:0051128	0.860	regulation of cellular component organization
GO:0044093	0.797	positive regulation of molecular function
GO:0009987	0.777	cellular process
GO:0050790	0.765	regulation of catalytic activity
GO:0043085	0.738	positive regulation of catalytic activity
GO:0051336	0.727	regulation of hydrolase activity
GO:0050896	0.638	response to stimulus
GO:0019222	0.614	regulation of metabolic process
GO:0051171	0.569	regulation of nitrogen compound metabolic process
GO:0031323	0.563	regulation of cellular metabolic process
GO:0080090	0.558	regulation of primary metabolic process
GO:0060255	0.553	regulation of macromolecule metabolic process
GO:0044087	0.535	regulation of cellular component biogenesis
GO:0044089	0.484	positive regulation of cellular component biogenesis
GO:0010638	0.484	positive regulation of organelle organization
GO:0043087	0.416	regulation of GTPase activity
GO:0051716	0.408	cellular response to stimulus
GO:0031399	0.393	regulation of protein modification process
GO:0019220	0.392	regulation of phosphate metabolic process
GO:0009893	0.327	positive regulation of metabolic process
GO:0031325	0.323	positive regulation of cellular metabolic process
GO:0051492	0.313	regulation of stress fiber assembly
GO:0042325	0.309	regulation of phosphorylation
GO:0010604	0.304	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.998	plasma membrane
GO:0005654	0.995	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]