StarFunc result for job id Q12778

User Input

>input (655 residues)
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLP
HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4L7N3	0.212	0.210	1.276E-85	662	0.957	0.947	A4L7N3.pdb.gz	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
2	AFDB:A3RK74	0.226	0.227	4.197E-47	652	0.579	0.581	A3RK74.pdb.gz	FX1AA_DANRE Forkhead box protein O1-A OS=Danio rerio OX=7955 GN=foxo1a PE=2 SV=1
3	AFDB:A3RK75	0.222	0.228	2.989E-45	629	0.505	0.526	A3RK75.pdb.gz	FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio OX=7955 GN=foxo1b PE=2 SV=1
4	AFDB:F1NNE8	0.189	0.188	9.605E-41	660	0.478	0.474	F1NNE8.pdb.gz	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
5	AFDB:O43524	0.218	0.213	9.605E-41	673	0.478	0.465	O43524.pdb.gz	FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3 PE=1 SV=1
6	AFDB:B3DGQ4	0.180	0.181	5.417E-35	651	0.427	0.430	B3DGQ4.pdb.gz
7	AFDB:Q5I0F7	0.186	0.189	1.024E-34	643	0.406	0.414	Q5I0F7.pdb.gz	Q5I0F7_DANRE Forkhead box O3A OS=Danio rerio OX=7955 GN=fb50g02 PE=2 SV=1
8	PDB:2hdcA	0.105	0.561	2.471E-5	97	0.053	0.361	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
9	AFDB:P40656	0.080	0.079	6.099E-4	669	0.156	0.152	P40656.pdb.gz	SOX14_DROME Putative transcription factor SOX-14 OS=Drosophila melanogaster OX=7227 GN=Sox14 PE=2 SV=3
10	AFDB:Q9W3Q5	0.121	0.066	9.524E-4	1268	0.197	0.102	Q9W3Q5.pdb.gz	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4
11	AFDB:Q9Z2U4	0.110	0.110	9.524E-4	655	0.153	0.153	Q9Z2U4.pdb.gz	ELF4_MOUSE ETS-related transcription factor Elf-4 OS=Mus musculus OX=10090 GN=Elf4 PE=1 SV=2
12	PDB:6qpqD	0.093	0.545	3.984E-2	82	0.014	0.110	6qpqD.pdb.gz
13	PDB:7k5yU	0.085	0.491	4.823E-2	75	0.035	0.307	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
14	PDB:3euhC	0.098	0.269	1.104E-1	206	0.026	0.083	3euhC.pdb.gz
15	PDB:2nyxB	0.087	0.321	1.424E-1	147	0.012	0.054	2nyxB.pdb.gz
16	PDB:2qbyB	0.089	0.149	1.424E-1	368	0.018	0.033	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
17	PDB:5fj9O	0.087	0.105	1.424E-1	528	0.021	0.027	5fj9O.pdb.gz	Molecular Structures of Unbound and Transcribing RNA Polymerase III.
18	PDB:6i6mB	0.091	0.155	1.517E-1	357	0.017	0.031	6i6mB.pdb.gz	Structure of Papaver somniferum O-Methyltransferase 1 Reveals Initiation of Noscapine Biosynthesis with Implications for Plant Natural Product Methylation
19	PDB:6zmiCE	0.091	0.692	1.836E-1	72	0.011	0.097	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
20	PDB:6iwtA	0.081	0.138	1.957E-1	346	0.020	0.038	6iwtA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3RK74	0.0	584	652	0.569	0.572	FX1AA_DANRE Forkhead box protein O1-A OS=Danio rerio OX=7955 GN=foxo1a PE=2 SV=1
2	A3RK75	0.0	546	629	0.544	0.566	FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio OX=7955 GN=foxo1b PE=2 SV=1
3	A4L7N3	0.0	1173	662	0.950	0.940	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
4	F1RME6	0.0	1189	662	0.944	0.934	F1RME6_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=4 SV=2
5	G3V7R4	0.0	1124	649	0.919	0.928	FOXO1_RAT Forkhead box protein O1 OS=Rattus norvegicus OX=10116 GN=Foxo1 PE=1 SV=1
6	Q12778	0.0	1336	655	1.000	1.000	FOXO1_HUMAN Forkhead box protein O1 OS=Homo sapiens OX=9606 GN=FOXO1 PE=1 SV=2
7	Q9R1E0	0.0	1097	652	0.915	0.919	FOXO1_MOUSE Forkhead box protein O1 OS=Mus musculus OX=10090 GN=Foxo1 PE=1 SV=2
8	O43524	4.69e-151	454	673	0.481	0.468	FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3 PE=1 SV=1
9	D3ZBQ1	5.03e-145	439	672	0.479	0.467	D3ZBQ1_RAT Forkhead box O3 OS=Rattus norvegicus OX=10116 GN=Foxo3 PE=1 SV=1
10	Q9WVH4	1.87e-142	432	672	0.479	0.467	FOXO3_MOUSE Forkhead box protein O3 OS=Mus musculus OX=10090 GN=Foxo3 PE=1 SV=1
11	F1NNE8	2.09e-135	413	660	0.392	0.389	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
12	Q9W7F8	1.59e-121	377	651	0.432	0.435	Q9W7F8_DANRE Forkhead box protein O3 OS=Danio rerio OX=7955 GN=fkhr PE=2 SV=1
13	Q5I0F7	7.16e-101	323	643	0.328	0.334	Q5I0F7_DANRE Forkhead box O3A OS=Danio rerio OX=7955 GN=fb50g02 PE=2 SV=1
14	Q9WVH3	1.28e-95	305	505	0.330	0.428	FOXO4_MOUSE Forkhead box protein O4 OS=Mus musculus OX=10090 GN=Foxo4 PE=1 SV=1
15	D4A433	7.82e-92	295	505	0.334	0.434	D4A433_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=1
16	P98177	1.18e-81	268	505	0.278	0.360	FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens OX=9606 GN=FOXO4 PE=1 SV=5
17	A0A096MJF0	1.47e-81	266	450	0.308	0.449	A0A096MJF0_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=2
18	Q70KY4	3.38e-77	258	559	0.249	0.292	FOXO6_MOUSE Forkhead box protein O6 OS=Mus musculus OX=10090 GN=Foxo6 PE=1 SV=1
19	A8MYZ6	3.17e-68	233	492	0.188	0.250	FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens OX=9606 GN=FOXO6 PE=1 SV=1
20	Q95V55	4.59e-64	224	613	0.192	0.206	FOXO_DROME Forkhead box protein O OS=Drosophila melanogaster OX=7227 GN=foxo PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	1.9e-22	90.5	Forkhead domain
2	PF16676 FOXO-TAD	1.2e-15	69.0	Transactivation domain of FOXO protein family
3	PF16675 FOXO_KIX_bdg	6.9e-26	101.7	KIX-binding domain of forkhead box O, CR2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368880

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000212015	0.999	NAD-dependent protein deacetylase sirtuin-1
2	9606.ENSP00000344456	0.999	Catenin beta-1
3	9606.ENSP00000274255	0.998	S-phase kinase-associated protein 2
4	9606.ENSP00000346437	0.998	Ubiquitin-like modifier-activating enzyme ATG7
5	9606.ENSP00000451828	0.998	RAC-alpha serine/threonine-protein kinase
6	9606.ENSP00000264867	0.997	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
7	9606.ENSP00000249396	0.996	NAD-dependent protein deacetylase sirtuin-2
8	9606.ENSP00000263253	0.996	Histone acetyltransferase p300
9	9606.ENSP00000340989	0.995	14-3-3 protein sigma
10	9606.ENSP00000264657	0.993	Signal transducer and activator of transcription 3
11	9606.ENSP00000262367	0.992	CREB-binding protein
12	9606.ENSP00000305422	0.992	CCAAT/enhancer-binding protein beta
13	9606.ENSP00000427514	0.989	CCAAT/enhancer-binding protein alpha
14	9606.ENSP00000375921	0.987	Paired box protein Pax-3
15	9606.ENSP00000363822	0.981	Androgen receptor
16	9606.ENSP00000379287	0.981	14-3-3 protein zeta/delta
17	9606.ENSP00000253801	0.980	Glucose-6-phosphatase
18	9606.ENSP00000380432	0.980	Insulin
19	9606.ENSP00000332973	0.979	Mothers against decapentaplegic homolog 3
20	9606.ENSP00000376436	0.978	Protein C-ets-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0000981	0.992	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003690	0.974	double-stranded DNA binding
GO:1990837	0.961	sequence-specific double-stranded DNA binding
GO:0019899	0.928	enzyme binding
GO:0001217	0.593	DNA-binding transcription repressor activity
GO:0001227	0.495	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0008134	0.471	transcription factor binding
GO:0019900	0.347	kinase binding
GO:0008013	0.338	beta-catenin binding
GO:0019901	0.306	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0048519	0.994	negative regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0009987	0.990	cellular process
GO:0019222	0.990	regulation of metabolic process
GO:0048518	0.986	positive regulation of biological process
GO:0031325	0.984	positive regulation of cellular metabolic process
GO:0051716	0.971	cellular response to stimulus
GO:0006355	0.970	regulation of DNA-templated transcription
GO:0010604	0.931	positive regulation of macromolecule metabolic process
GO:0048523	0.926	negative regulation of cellular process
GO:0009891	0.914	positive regulation of biosynthetic process
GO:0042221	0.912	response to chemical
GO:0007154	0.892	cell communication
GO:0051173	0.880	positive regulation of nitrogen compound metabolic process
GO:0008152	0.879	metabolic process
GO:0071704	0.864	organic substance metabolic process
GO:0031328	0.855	positive regulation of cellular biosynthetic process
GO:0070887	0.847	cellular response to chemical stimulus
GO:0044238	0.840	primary metabolic process
GO:0044237	0.792	cellular metabolic process
GO:0006950	0.791	response to stress
GO:0023052	0.762	signaling
GO:0010033	0.741	response to organic substance
GO:0007165	0.719	signal transduction
GO:0006357	0.714	regulation of transcription by RNA polymerase II
GO:0048583	0.712	regulation of response to stimulus
GO:0045893	0.709	positive regulation of DNA-templated transcription
GO:0006807	0.703	nitrogen compound metabolic process
GO:0032502	0.694	developmental process
GO:0043170	0.658	macromolecule metabolic process
GO:1901564	0.595	organonitrogen compound metabolic process
GO:0019538	0.575	protein metabolic process
GO:0048856	0.545	anatomical structure development
GO:0032501	0.531	multicellular organismal process
GO:0010646	0.531	regulation of cell communication
GO:0023051	0.529	regulation of signaling
GO:0071310	0.525	cellular response to organic substance
GO:0050793	0.520	regulation of developmental process
GO:0036211	0.501	protein modification process
GO:0009719	0.498	response to endogenous stimulus
GO:0010605	0.470	negative regulation of macromolecule metabolic process
GO:0006793	0.469	phosphorus metabolic process
GO:0071495	0.468	cellular response to endogenous stimulus
GO:1901700	0.466	response to oxygen-containing compound
GO:0009966	0.460	regulation of signal transduction
GO:0016310	0.456	phosphorylation
GO:0033554	0.455	cellular response to stress
GO:0048585	0.451	negative regulation of response to stimulus
GO:0051239	0.443	regulation of multicellular organismal process
GO:1901701	0.419	cellular response to oxygen-containing compound
GO:0031324	0.409	negative regulation of cellular metabolic process
GO:0018193	0.409	peptidyl-amino acid modification
GO:0051172	0.381	negative regulation of nitrogen compound metabolic process
GO:0045595	0.368	regulation of cell differentiation
GO:0007166	0.368	cell surface receptor signaling pathway
GO:0006468	0.336	protein phosphorylation
GO:0045944	0.330	positive regulation of transcription by RNA polymerase II
GO:0007275	0.324	multicellular organism development
GO:0010941	0.310	regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0005829	0.993	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]