StarFunc result for job id Q12789

User Input

>input (2109 residues)
MDALESLLDEVALEGLDGLCLPALWSRLETRVPPFPLPLEPCTQEFLWRALATHPGISFY
EEPRERPDLQLQDRYEEIDLETGILESRRDPVALEDVYPIHMILENKDGIQGSCRYFKER
KNITNDIRTKSLQPRCTMVEAFDRWGKKLIIVASQAMRYRALIGQEGDPDLKLPDFSYCI
LERLGRSRWQGELQRDLHTTAFKVDAGKLHYHRKILNKNGLITMQSHVIRLPTGAQQHSI
LLLLNRFHVDRRSKYDILMEKLSVMLSTRTNHIETLGKLREELGLCERTFKRLYQYMLNA
GLAKVVSLRLQEIHPECGPCKTKKGTDVMVRCLKLLKEFKRNDHDDDEDEEVISKTVPPV
DIVFERDMLTQTYDLIERRGTKGISQAEIRVAMNVGKLEARMLCRLLQRFKVVKGFMEDE
GRQRTTKYISCVFAEESDLSRQYQREKARSELLTTVSLASMQEESLLPEGEDTFLSESDS
EEERSSSKRRGRGSQKDTRASANLRPKTQPHHSTPTKGGWKVVNLHPLKKQPPSFPGAAE
ERACQSLASRDSLLDTSSVSEPNVSFVSHCADSNSGDIAVIEEVRMENPKESSSSLKTGR
HSSGQDKPHETYRLLKRRNLIIEAVTNLRLIESLFTIQKMIMDQEKQEGVSTKCCKKSIV
RLVRNLSEEGLLRLYRTTVIQDGIKKKVDLVVHPSMDQNDPLVRSAIEQVRFRISNSSTA
NRVKTSQPPVPQGEAEEDSQGKEGPSGSGDSQLSASSRSESGRMKKSDNKMGITPLRNYH
PIVVPGLGRSLGFLPKMPRLRVVHMFLWYLIYGHPASNTVEKPSFISERRTIKQESGRAG
VRPSSSGSAWEACSEAPSKGSQDGVTWEAEVELATETVYVDDASWMRYIPPIPVHRDFGF
GWALVSDILLCLPLSIFIQIVQVSYKVDNLEEFLNDPLKKHTLIRFLPRPIRQQLLYKRR
YIFSVVENLQRLCYMGLLQFGPTEKFQDKDQVFIFLKKNAVIVDTTICDPHYNLARSSRP
FERRLYVLNSMQDVENYWFDLQCVCLNTPLGVVRCPRVRKNSSTDQGSDEEGSLQKEQES
AMDKHNLERKCAMLEYTTGSREVVDEGLIPGDGLGAAGLDSSFYGHLKRNWIWTSYIINQ
AKKENTAAENGLTVRLQTFLSKRPMPLSARGNSRLNIWGEARVGSELCAGWEEQFEVDRE
PSLDRNRRVRGGKSQKRKRLKKDPGKKIKRKKKGEFPGEKSKRLRYHDEADQSALQRMTR
LRVTWSMQEDGLLVLCRIASNVLNTKVKGPFVTWQVVRDILHATFEESLDKTSHSVGRRA
RYIVKNPQAYLNYKVCLAEVYQDKALVGDFMNRRGDYDDPKVCANEFKEFVEKLKEKFSS
ALRNSNLEIPDTLQELFARYRVLAIGDEKDQTRKEDELNSVDDIHFLVLQNLIQSTLALS
DSQMKSYQSFQTFRLYREYKDHVLVKAFMECQKRSLVNRRRVNHTLGPKKNRALPFVPMS
YQLSQTYYRIFTWRFPSTICTESFQFLDRMRAAGKLDQPDRFSFKDQDNNEPTNDMVAFS
LDGPGGNCVAVLTLFSLGLISVDVRIPEQIIVVDSSMVENEVIKSLGKDGSLEDDEDEED
DLDEGVGGKRRSMEVKPAQASHTNYLLMRGYYSPGIVSTRNLNPNDSIVVNSCQMKFQLR
CTPVPARLRPAAAPLEELTMGTSCLPDTFTKLINPQENTCSLEEFVLQLELSGYSPEDLT
AALEILEAIIATGCFGIDKEELRRRFSALEKAGGGRTRTFADCIQALLEQHQVLEVGGNT
ARLVAMGSAWPWLLHSVRLKDREDADIQREDPQARPLEGSSSEDSPPEGQAPPSHSPRGT
KRRASWASENGETDAEGTQMTPAKRPALQDSNLAPSLGPGAEDGAEAQAPSPPPALEDTA
AAGAAQEDQEGVGEFSSPGQEQLSGQAQPPEGSEDPRGFTESFGAANISQAARERDCESV
CFIGRPWRVVDGHLNLPVCKGMMEAMLYHIMTRPGIPESSLLRHYQGVLQPVAVLELLQG
LESLGCIRKRWLRKPRPVSLFSTPVVEEVEVPSSLDESPMAFYEPTLDCTLRLGRVFPHE
VNWNKWIHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12789	1.000	1.000	0.000	2109	1.000	1.000	Q12789.pdb.gz	TF3C1_HUMAN General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1 PE=1 SV=4
2	AFDB:Q8K284	0.339	0.340	0.000	2101	0.787	0.790	Q8K284.pdb.gz	TF3C1_MOUSE General transcription factor 3C polypeptide 1 OS=Mus musculus OX=10090 GN=Gtf3c1 PE=1 SV=2
3	PDB:3cuqA	0.029	0.234	7.530E-2	219	0.009	0.082	3cuqA.pdb.gz
4	AFDB:Q9C7B1	0.034	0.076	1.352E-1	619	0.048	0.165	Q9C7B1.pdb.gz	TRP3_ARATH Telomere repeat-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=TRP3 PE=1 SV=1
5	AFDB:A0A1D8PCC3	0.041	0.055	1.781E-1	1411	0.054	0.081	A0A1D8PCC3.pdb.gz	A0A1D8PCC3_CANAL Transcriptional regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIN3 PE=4 SV=1
6	AFDB:Q9FFY9	0.028	0.071	1.865E-1	640	0.046	0.152	Q9FFY9.pdb.gz	TRP4_ARATH Telomere repeat-binding protein 4 OS=Arabidopsis thaliana OX=3702 GN=TRP4 PE=1 SV=1
7	AFDB:Q9W523	0.033	0.040	3.092E-1	1537	0.068	0.094	Q9W523.pdb.gz	Q9W523_DROME Polyhomeotic distal, isoform A OS=Drosophila melanogaster OX=7227 GN=ph-d PE=4 SV=3
8	AFDB:Q9XTP7	0.041	0.084	3.891E-1	719	0.044	0.129	Q9XTP7.pdb.gz	Q9XTP7_DROME DOMINA protein OS=Drosophila melanogaster OX=7227 GN=jumu PE=2 SV=1
9	AFDB:Q3TUF7	0.030	0.040	4.677E-1	1407	0.052	0.077	Q3TUF7.pdb.gz	YETS2_MOUSE YEATS domain-containing protein 2 OS=Mus musculus OX=10090 GN=Yeats2 PE=1 SV=2
10	AFDB:Q8N1G1	0.031	0.044	4.897E-1	1221	0.056	0.097	Q8N1G1.pdb.gz	REXO1_HUMAN RNA exonuclease 1 homolog OS=Homo sapiens OX=9606 GN=REXO1 PE=1 SV=3
11	PDB:7a6hO	0.038	0.119	4.960E-1	512	0.015	0.061	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
12	PDB:7d58O	0.033	0.105	4.960E-1	490	0.017	0.071	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
13	PDB:7tjjI	0.035	0.171	5.438E-1	380	0.006	0.032	7tjjI.pdb.gz	A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
14	AFDB:Q0KI50	0.036	0.040	5.622E-1	1854	0.069	0.078	Q0KI50.pdb.gz	DMDD_DROME Dystrophin, isoform D OS=Drosophila melanogaster OX=7227 GN=Dys PE=1 SV=1
15	PDB:2qbyB	0.032	0.159	6.844E-1	368	0.007	0.041	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
16	PDB:7vo0G	0.034	0.401	9.442E-1	131	0.009	0.145	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
17	PDB:6v9iC	0.029	0.079	9.886E-1	730	0.006	0.016	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
18	PDB:5afqB	0.026	0.118	1.084	444	0.011	0.052	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
19	PDB:7odrO	0.028	0.201	1.084	154	0.009	0.117	7odrO.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
20	PDB:6qpqD	0.030	0.508	1.135	82	0.005	0.122	6qpqD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12789	0.0	4367	2109	1.000	1.000	TF3C1_HUMAN General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1 PE=1 SV=4
2	Q8K284	0.0	3182	2101	0.784	0.787	TF3C1_MOUSE General transcription factor 3C polypeptide 1 OS=Mus musculus OX=10090 GN=Gtf3c1 PE=1 SV=2
3	Q8IQ95	1.9	36.2	1240	0.013	0.023	Q8IQ95_DROME Pebble, isoform D OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
4	Q8IQ97	1.9	36.2	1311	0.013	0.021	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
5	P31651	3.5	35.0	614	0.014	0.047	S6A12_MOUSE Sodium- and chloride-dependent betaine transporter OS=Mus musculus OX=10090 GN=Slc6a12 PE=1 SV=1
6	Q9U7D8	3.8	35.0	853	0.013	0.032	Q9U7D8_DROME FI23202p1 OS=Drosophila melanogaster OX=7227 GN=pbl PE=2 SV=1
7	Q8IQ96	3.9	35.0	782	0.013	0.035	Q8IQ96_DROME Pebble, isoform C OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
8	A8JNN0	4.0	35.0	900	0.013	0.030	A8JNN0_DROME Pebble, isoform E OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
9	P42843	4.2	35.0	763	0.017	0.046	SKP2_YEAST F-box protein SKP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKP2 PE=1 SV=1
10	D2NUE8	5.2	34.7	567	0.013	0.048	D2NUE8_DROME MIP14634p OS=Drosophila melanogaster OX=7227 GN=pbl PE=2 SV=1
11	Q9LMH6	7.2	34.3	736	0.017	0.048	FDM4_ARATH Factor of DNA methylation 4 OS=Arabidopsis thaliana OX=3702 GN=FDM4 PE=4 SV=1
12	Q5TC79	9.3	33.5	503	0.012	0.050	ZBT37_HUMAN Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens OX=9606 GN=ZBTB37 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04182 B-block_TFIIIC	1.9e-17	74.5	B-block binding subunit of TFIIIC

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348510

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351575	0.999	Transcription factor TFIIIB component B'' homolog
2	9606.ENSP00000361180	0.998	General transcription factor 3C polypeptide 5
3	9606.ENSP00000361219	0.997	General transcription factor 3C polypeptide 4
4	9606.ENSP00000263956	0.996	General transcription factor 3C polypeptide 3
5	9606.ENSP00000352536	0.995	General transcription factor 3C polypeptide 2
6	9606.ENSP00000448323	0.994	Transcription factor IIIB 90 kDa subunit
7	9606.ENSP00000370532	0.992	Transcription factor IIIA
8	9606.ENSP00000357863	0.982	General transcription factor 3C polypeptide 6
9	9606.ENSP00000354558	0.922	Serine/threonine-protein kinase mTOR
10	9606.ENSP00000263182	0.915	Gamma-butyrobetaine dioxygenase
11	9606.ENSP00000231509	0.904	Glucocorticoid receptor
12	9606.ENSP00000375942	0.903	TATA-box-binding protein
13	9606.ENSP00000380904	0.860	DNA-directed RNA polymerase III subunit RPC4
14	9606.ENSP00000334564	0.859	DNA-directed RNA polymerase III subunit RPC3
15	9606.ENSP00000263253	0.850	Histone acetyltransferase p300
16	9606.ENSP00000361446	0.834	DNA-directed RNA polymerase III subunit RPC1
17	9606.ENSP00000366828	0.833	DNA-directed RNA polymerase III subunit RPC6
18	9606.ENSP00000342889	0.813	DNA-directed RNA polymerases I, II, and III subunit RPABC4
19	9606.ENSP00000382058	0.791	DNA-directed RNA polymerase III subunit RPC7
20	9606.ENSP00000293860	0.771	DNA-directed RNA polymerase III subunit RPC10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000995	1.000	RNA polymerase III general transcription initiation factor activity
GO:0003677	1.000	DNA binding
GO:0003824	0.468	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0006351	0.959	DNA-templated transcription
GO:0009303	0.903	rRNA transcription
GO:0006383	0.889	transcription by RNA polymerase III
GO:0006399	0.819	tRNA metabolic process
GO:0065007	0.444	biological regulation
GO:0050794	0.398	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0016020	0.992	membrane
GO:0005667	0.774	transcription regulator complex
GO:0005737	0.757	cytoplasm
GO:0005730	0.678	nucleolus
GO:0090576	0.497	RNA polymerase III transcription regulator complex
GO:0000127	0.387	transcription factor TFIIIC complex
GO:0005829	0.351	cytosol
GO:1990904	0.309	ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]