StarFunc result for job id Q12791

User Input

>input (1236 residues)
MANGGGGGGGSSGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSSSSSSSSSS
VHEPKMDALIIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCH
CGGKTKEAQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVL
VVLVFALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKL
WFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKL
VNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYA
KTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLES
VSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVK
IESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSW
NWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNE
MYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEGTLG
FFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERD
CSCMSGRVRGNVDTLERAFPLSSVSVNDCSTSFRAFEDEQPSTLSPKKKQRNGGMRNSPN
TSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSG
HVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVS
ILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIG
VLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDD
DPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEEN
ALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRL
RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSS
KKSSSVHSIPSTANRQNRPKSRESRDKQKYVQEERL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7pxeA	0.695	0.966	0.000	885	0.486	0.679	7pxeA.pdb.gz	Small molecule modulation of the Drosophila Slo channel elucidated by cryo-EM.
2	AFDB:A0A2R8QRZ7	0.817	0.822	0.000	1229	0.838	0.843	A0A2R8QRZ7.pdb.gz	A0A2R8QRZ7_DANRE BK channel OS=Danio rerio OX=7955 GN=kcnma1 PE=3 SV=1
3	AFDB:F1QYL4	0.817	0.838	0.000	1205	0.841	0.862	F1QYL4.pdb.gz	F1QYL4_DANRE BK channel OS=Danio rerio OX=7955 GN=kcnma1 PE=3 SV=3
4	AFDB:H7BRC9	0.764	0.812	0.000	1160	0.497	0.529	H7BRC9.pdb.gz	H7BRC9_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
5	AFDB:H8ESD6	0.758	0.816	0.000	1146	0.506	0.545	H8ESD6.pdb.gz	H8ESD6_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
6	AFDB:Q03720	0.766	0.788	0.000	1200	0.531	0.547	Q03720.pdb.gz	SLO_DROME Calcium-activated potassium channel slowpoke OS=Drosophila melanogaster OX=7227 GN=slo PE=1 SV=3
7	AFDB:Q08460	0.860	0.878	0.000	1209	0.933	0.954	Q08460.pdb.gz	KCMA1_MOUSE Calcium-activated potassium channel subunit alpha-1 OS=Mus musculus OX=10090 GN=Kcnma1 PE=1 SV=2
8	AFDB:Q12791	1.000	1.000	0.000	1236	1.000	1.000	Q12791.pdb.gz	KCMA1_HUMAN Calcium-activated potassium channel subunit alpha-1 OS=Homo sapiens OX=9606 GN=KCNMA1 PE=1 SV=2
9	AFDB:O54982	0.743	0.818	2.791E-99	1121	0.387	0.426	O54982.pdb.gz	KCNU1_MOUSE Potassium channel subfamily U member 1 OS=Mus musculus OX=10090 GN=Kcnu1 PE=1 SV=2
10	AFDB:A8MYU2	0.724	0.776	1.427E-96	1149	0.387	0.416	A8MYU2.pdb.gz	KCNU1_HUMAN Potassium channel subfamily U member 1 OS=Homo sapiens OX=9606 GN=KCNU1 PE=1 SV=2
11	AFDB:Q9Z258	0.527	0.527	4.050E-42	1237	0.179	0.179	Q9Z258.pdb.gz	KCNT1_RAT Potassium channel subfamily T member 1 OS=Rattus norvegicus OX=10116 GN=Kcnt1 PE=1 SV=1
12	PDB:6u68A	0.163	0.558	1.173E-12	319	0.055	0.213	6u68A.pdb.gz
13	PDB:3rbzA	0.184	0.635	1.739E-10	289	0.052	0.221	3rbzA.pdb.gz	Structures of multiple Ca2+-binding sites in a K+ channel RCK domain
14	PDB:4j7cB	0.108	0.496	4.344E-5	217	0.032	0.180	4j7cB.pdb.gz	The structure of the KtrAB potassium transporter
15	PDB:7f3fA	0.107	0.250	2.482E-4	460	0.040	0.109	7f3fA.pdb.gz
16	PDB:7sizB	0.101	0.321	4.110E-4	334	0.034	0.126	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
17	PDB:7w6sB	0.084	0.197	5.665E-4	448	0.037	0.103	7w6sB.pdb.gz
18	PDB:7wswA	0.136	0.307	7.810E-4	472	0.051	0.133	7wswA.pdb.gz
19	PDB:1nvmB	0.099	0.323	8.176E-4	312	0.029	0.115	1nvmB.pdb.gz	Crystal structure of a bifunctional aldolase-dehydrogenase: Sequestering a reactive and volatile intermediate
20	PDB:7phhA	0.088	0.227	9.382E-4	396	0.041	0.129	7phhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QRZ7	2040	1229	0.835	0.840	A0A2R8QRZ7_DANRE BK channel OS=Danio rerio OX=7955 GN=kcnma1 PE=3 SV=1
2	A8MYU2	858	1149	0.388	0.417	KCNU1_HUMAN Potassium channel subfamily U member 1 OS=Homo sapiens OX=9606 GN=KCNU1 PE=1 SV=2
3	B7ZC96	2054	1184	0.835	0.872	KCMA1_DANRE Calcium-activated potassium channel subunit alpha-1a OS=Danio rerio OX=7955 GN=kcnma1a PE=1 SV=1
4	C3VLD3	2203	1195	0.875	0.905	C3VLD3_MOUSE Calcium-activated potassium channel subunit alpha-1 OS=Mus musculus OX=10090 GN=Kcnma1 PE=1 SV=1
5	F1QYL4	2050	1205	0.836	0.857	F1QYL4_DANRE BK channel OS=Danio rerio OX=7955 GN=kcnma1 PE=3 SV=3
6	H7BRC9	1164	1160	0.521	0.555	H7BRC9_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
7	H7BRM4	1167	1153	0.518	0.555	H7BRM4_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
8	H7BRM5	1172	1118	0.515	0.569	H7BRM5_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
9	H7BRM7	1174	1131	0.516	0.564	H7BRM7_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
10	H8ESD6	1166	1146	0.516	0.557	H8ESD6_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
11	H8ESD8	1172	1138	0.518	0.562	H8ESD8_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
12	H8ESE2	1167	1160	0.521	0.555	H8ESE2_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
13	H8ESE3	1170	1153	0.518	0.555	H8ESE3_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
14	H8ESE4	1170	1138	0.518	0.562	H8ESE4_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
15	H8ESE5	1167	1140	0.522	0.566	H8ESE5_CAEEL BK channel OS=Caenorhabditis elegans OX=6239 GN=slo-1 PE=1 SV=1
16	O18866	2278	1152	0.910	0.977	KCMA1_PIG Calcium-activated potassium channel subunit alpha-1 (Fragment) OS=Sus scrofa OX=9823 GN=KCNMA1 PE=2 SV=2
17	O54982	862	1121	0.392	0.432	KCNU1_MOUSE Potassium channel subfamily U member 1 OS=Mus musculus OX=10090 GN=Kcnu1 PE=1 SV=2
18	Q03720	1248	1200	0.531	0.547	SLO_DROME Calcium-activated potassium channel slowpoke OS=Drosophila melanogaster OX=7227 GN=slo PE=1 SV=3
19	Q08460	2292	1209	0.923	0.944	KCMA1_MOUSE Calcium-activated potassium channel subunit alpha-1 OS=Mus musculus OX=10090 GN=Kcnma1 PE=1 SV=2
20	Q12791	2573	1236	1.000	1.000	KCMA1_HUMAN Calcium-activated potassium channel subunit alpha-1 OS=Homo sapiens OX=9606 GN=KCNMA1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03493 BK_channel_a	3.7e-26	102.7	Calcium-activated BK potassium channel alpha subunit
2	PF00520 Ion_trans	2.6e-14	64.6	Ion transport protein
3	PF07885 Ion_trans_2	3e-10	51.2	Ion channel
4	PF00060 Lig_chan	4.6e+02	12.1	Ligand-gated ion channel
5	PF02254 TrkA_N	0.062	24.9	TrkA-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286628

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274629	0.990	Calcium-activated potassium channel subunit beta-1
2	9606.ENSP00000319370	0.987	Calcium-activated potassium channel subunit beta-3
3	9606.ENSP00000258111	0.984	Calcium-activated potassium channel subunit beta-4
4	9606.ENSP00000262888	0.966	Intermediate conductance calcium-activated potassium channel protein 4
5	9606.ENSP00000476519	0.952	Small conductance calcium-activated potassium channel protein 1
6	9606.ENSP00000427120	0.947	Small conductance calcium-activated potassium channel protein 2
7	9606.ENSP00000481848	0.943	Small conductance calcium-activated potassium channel protein 3
8	9606.ENSP00000407592	0.942	Potassium large conductance calcium-activated channel, subfamily M, beta member 2
9	9606.ENSP00000363092	0.941	cGMP-dependent protein kinase 1
10	9606.ENSP00000266376	0.935	Voltage-dependent L-type calcium channel subunit alpha-1C
11	9606.ENSP00000264399	0.918	cGMP-dependent protein kinase 2
12	9606.ENSP00000419313	0.916	Short transient receptor potential channel 1
13	9606.ENSP00000360597	0.902	Leucine-rich repeat-containing protein 26
14	9606.ENSP00000339191	0.897	Caveolin-1
15	9606.ENSP00000231948	0.865	Protein cereblon
16	9606.ENSP00000288139	0.864	Voltage-dependent L-type calcium channel subunit alpha-1D
17	9606.ENSP00000366488	0.864	cAMP-dependent protein kinase catalytic subunit gamma
18	9606.ENSP00000309591	0.859	cAMP-dependent protein kinase catalytic subunit alpha
19	9606.ENSP00000359719	0.859	cAMP-dependent protein kinase catalytic subunit beta
20	9606.ENSP00000254488	0.853	Sodium- and chloride-dependent GABA transporter 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015269	1.000	calcium-activated potassium channel activity
GO:0005249	1.000	voltage-gated potassium channel activity
GO:0042802	0.971	identical protein binding
GO:0008092	0.346	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0009987	0.979	cellular process
GO:0006810	0.967	transport
GO:0050896	0.961	response to stimulus
GO:0032501	0.945	multicellular organismal process
GO:0065008	0.938	regulation of biological quality
GO:0006811	0.904	monoatomic ion transport
GO:0030001	0.845	metal ion transport
GO:0050794	0.819	regulation of cellular process
GO:0006813	0.762	potassium ion transport
GO:0009628	0.751	response to abiotic stimulus
GO:0003008	0.730	system process
GO:0042391	0.729	regulation of membrane potential
GO:0008015	0.461	blood circulation
GO:0044057	0.459	regulation of system process
GO:0055085	0.455	transmembrane transport
GO:0042221	0.450	response to chemical
GO:0090257	0.418	regulation of muscle system process
GO:0090066	0.416	regulation of anatomical structure size
GO:0006937	0.396	regulation of muscle contraction
GO:0003012	0.395	muscle system process
GO:0010033	0.392	response to organic substance
GO:0003018	0.386	vascular process in circulatory system
GO:0035296	0.383	regulation of tube diameter
GO:0097746	0.364	blood vessel diameter maintenance
GO:0006940	0.356	regulation of smooth muscle contraction
GO:0048518	0.330	positive regulation of biological process
GO:0071840	0.316	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.965	protein-containing complex
GO:0098590	0.853	plasma membrane region
GO:0098797	0.849	plasma membrane protein complex
GO:0034703	0.833	cation channel complex
GO:0034705	0.675	potassium channel complex
GO:0030054	0.651	cell junction
GO:0005622	0.572	intracellular anatomical structure
GO:0005737	0.507	cytoplasm
GO:0008076	0.479	voltage-gated potassium channel complex
GO:0043226	0.446	organelle
GO:0045202	0.444	synapse
GO:0120025	0.368	plasma membrane bounded cell projection
GO:0043227	0.332	membrane-bounded organelle
GO:0043229	0.313	intracellular organelle
GO:0043005	0.308	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]