StarFunc result for job id Q12800

User Input

>input (502 residues)
MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDN
ENKILPFQYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPEINGKLVKSIF
RVVFHDRRLQYTEHQQLEGWRWNRPGDRILDIDIPMSVGIIDPRANPTQLNTVEFLWDPA
KRTSVFIQVHCISTEFTMRKHGGEKGVPFRVQIDTFKENENGEYTEHLHSASCQIKVFKP
KGADRKQKTDREKMEKRTPHEKEKYQPSYETTILTECSPWPEITYVNNSPSPGFNSSHSS
FSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFTNFSGADLLKL
TRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQQQQQQQQQKHEDGDS
NGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQE
EACFILDTMKAETNDSYHIILK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R120	0.506	0.506	1.401E-95	502	1.000	1.000	A0A024R120.pdb.gz
2	AFDB:A0A024R2J0	0.483	0.481	2.365E-80	504	0.741	0.738	A0A024R2J0.pdb.gz
3	AFDB:F8VX55	0.445	0.526	7.658E-79	424	0.845	1.000	F8VX55.pdb.gz	F8VX55_HUMAN Transcription factor CP2 OS=Homo sapiens OX=9606 GN=TFCP2 PE=1 SV=1
4	AFDB:Q811S7	0.434	0.404	3.492E-77	540	0.737	0.685	Q811S7.pdb.gz	UBIP1_MOUSE Upstream-binding protein 1 OS=Mus musculus OX=10090 GN=Ubp1 PE=1 SV=1
5	AFDB:Q3UNW5	0.456	0.477	1.523E-73	479	0.675	0.708	Q3UNW5.pdb.gz	TF2L1_MOUSE Transcription factor CP2-like protein 1 OS=Mus musculus OX=10090 GN=Tfcp2l1 PE=1 SV=2
6	AFDB:G5EDF0	0.402	0.361	2.019E-29	563	0.231	0.206	G5EDF0.pdb.gz	GRH1_CAEEL Grainyhead-like protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=grh-1 PE=2 SV=1
7	AFDB:P13002	0.395	0.170	2.396E-29	1333	0.255	0.096	P13002.pdb.gz	ELF1_DROME Protein grainyhead OS=Drosophila melanogaster OX=7227 GN=grh PE=1 SV=3
8	AFDB:Q5FWH3	0.398	0.340	2.344E-28	603	0.209	0.174	Q5FWH3.pdb.gz	GRHL3_MOUSE Grainyhead-like protein 3 homolog OS=Mus musculus OX=10090 GN=Grhl3 PE=1 SV=1
9	AFDB:Q921D9	0.367	0.301	3.915E-28	618	0.245	0.199	Q921D9.pdb.gz	GRHL1_MOUSE Grainyhead-like protein 1 homolog OS=Mus musculus OX=10090 GN=Grhl1 PE=1 SV=1
10	AFDB:E7F6C3	0.374	0.339	5.391E-27	557	0.199	0.180	E7F6C3.pdb.gz
11	PDB:6xreM	0.216	0.318	1.487E-4	314	0.058	0.092	6xreM.pdb.gz	Structure of the p53/RNA polymerase II assembly.
12	PDB:1yvlB	0.141	0.114	5.211E-4	653	0.048	0.037	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
13	PDB:4f38B	0.147	0.318	1.934E-3	192	0.040	0.104	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
14	PDB:1kiuB	0.123	0.176	5.713E-3	279	0.036	0.065	1kiuB.pdb.gz	Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.
15	PDB:5hp5A	0.142	0.110	6.403E-3	669	0.020	0.015	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
16	PDB:1q90A	0.157	0.248	8.515E-3	292	0.056	0.096	1q90A.pdb.gz	An Atypical Haem in the Cytochrome B6F Complex
17	PDB:5n0zA	0.129	0.105	1.070E-2	638	0.020	0.016	5n0zA.pdb.gz	Development of a Selective Inhibitor of Protein Arginine Deiminase 2.
18	PDB:3oaiA	0.135	0.137	1.269E-2	488	0.034	0.035	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
19	PDB:4x8gA	0.134	0.114	1.269E-2	606	0.016	0.013	4x8gA.pdb.gz	Inhibition of PAD4 activity is sufficient to disrupt mouse and human NET formation.
20	PDB:6hiwDC	0.145	0.076	1.594E-2	1095	0.070	0.032	6hiwDC.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTJ9	0.0	1014	501	0.970	0.972	A0A0G2JTJ9_RAT Transcription factor CP2 OS=Rattus norvegicus OX=10116 GN=Tfcp2 PE=3 SV=1
2	A0A8I6AB07	0.0	961	497	0.922	0.932	A0A8I6AB07_RAT Transcription factor CP2 OS=Rattus norvegicus OX=10116 GN=Tfcp2 PE=1 SV=1
3	F8VWL0	0.0	800	381	0.759	1.000	F8VWL0_HUMAN Transcription factor CP2 (Fragment) OS=Homo sapiens OX=9606 GN=TFCP2 PE=1 SV=1
4	F8VX55	0.0	647	424	0.612	0.724	F8VX55_HUMAN Transcription factor CP2 OS=Homo sapiens OX=9606 GN=TFCP2 PE=1 SV=1
5	G3V969	0.0	1000	497	0.962	0.972	G3V969_RAT Tcfcp2 protein OS=Rattus norvegicus OX=10116 GN=Tfcp2 PE=1 SV=2
6	Q12800	0.0	1050	502	1.000	1.000	TFCP2_HUMAN Alpha-globin transcription factor CP2 OS=Homo sapiens OX=9606 GN=TFCP2 PE=1 SV=2
7	Q3UNW5	0.0	698	479	0.681	0.714	TF2L1_MOUSE Transcription factor CP2-like protein 1 OS=Mus musculus OX=10090 GN=Tfcp2l1 PE=1 SV=2
8	Q811S7	0.0	740	540	0.735	0.683	UBIP1_MOUSE Upstream-binding protein 1 OS=Mus musculus OX=10090 GN=Ubp1 PE=1 SV=1
9	Q9ERA0	0.0	1014	502	0.966	0.966	TFCP2_MOUSE Alpha-globin transcription factor CP2 OS=Mus musculus OX=10090 GN=Tfcp2 PE=1 SV=1
10	Q9NZI6	0.0	738	479	0.695	0.729	TF2L1_HUMAN Transcription factor CP2-like protein 1 OS=Homo sapiens OX=9606 GN=TFCP2L1 PE=1 SV=1
11	Q9NZI7	0.0	755	540	0.743	0.691	UBIP1_HUMAN Upstream-binding protein 1 OS=Homo sapiens OX=9606 GN=UBP1 PE=1 SV=1
12	G5EDF0	1.08e-23	106	563	0.145	0.130	GRH1_CAEEL Grainyhead-like protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=grh-1 PE=2 SV=1
13	A0A286YAF2	3.13e-23	105	601	0.143	0.120	A0A286YAF2_DANRE Grainyhead-like protein 1 homolog OS=Danio rerio OX=7955 GN=fc49a04 PE=1 SV=2
14	E7FCE3	3.74e-23	105	613	0.143	0.117	E7FCE3_DANRE Grainyhead-like protein 1 homolog isoform X1 OS=Danio rerio OX=7955 GN=fc49a04 PE=1 SV=1
15	Q921D9	9.08e-22	100	618	0.147	0.120	GRHL1_MOUSE Grainyhead-like protein 1 homolog OS=Mus musculus OX=10090 GN=Grhl1 PE=1 SV=1
16	A0A2R8QAV0	1.96e-21	99.8	554	0.149	0.135	A0A2R8QAV0_DANRE Grainyhead-like protein 2 homolog OS=Danio rerio OX=7955 GN=grhl2 PE=4 SV=1
17	F7VJQ5	2.94e-21	99.4	601	0.149	0.125	F7VJQ5_DANRE Grainyhead-like 2b protein OS=Danio rerio OX=7955 GN=grhl2 PE=2 SV=1
18	Q9NZI5	1.37e-20	97.4	618	0.145	0.118	GRHL1_HUMAN Grainyhead-like protein 1 homolog OS=Homo sapiens OX=9606 GN=GRHL1 PE=1 SV=2
19	P13002	4.09e-20	96.7	1333	0.131	0.050	ELF1_DROME Protein grainyhead OS=Drosophila melanogaster OX=7227 GN=grh PE=1 SV=3
20	Q8TE85	8.18e-20	95.1	626	0.125	0.101	GRHL3_HUMAN Grainyhead-like protein 3 homolog OS=Homo sapiens OX=9606 GN=GRHL3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04516 CP2	4.4e-55	198.0	CP2 transcription factor
2	PF18016 SAM_3	1.1e-14	65.4	SAM domain (Sterile alpha motif)
3	PF16619 SUIM_assoc	55	15.1	Unstructured region C-term to UIM in Ataxin3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021589

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000001171	0.822	Uncharacterized protein
2	61853.ENSNLEP00000019526	0.730	Zinc finger protein 410
3	61853.ENSNLEP00000021127	0.711	Amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
4	61853.ENSNLEP00000008876	0.691	annotation not available
5	61853.ENSNLEP00000021427	0.686	Nuclear factor, erythroid 2
6	61853.ENSNLEP00000003167	0.666	Histone deacetylase 1
7	61853.ENSNLEP00000001990	0.637	Gamma-aminobutyric acid (GABA) A receptor, beta 3
8	61853.ENSNLEP00000020146	0.596	Estrogen-related receptor beta
9	61853.ENSNLEP00000013841	0.586	Dihydropyrimidine dehydrogenase [NADP(+)]
10	61853.ENSNLEP00000008340	0.566	Thymidylate synthetase
11	61853.ENSNLEP00000014498	0.548	Carboxypeptidase Z
12	61853.ENSNLEP00000007058	0.540	K(lysine) acetyltransferase 5
13	61853.ENSNLEP00000015855	0.518	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000977	0.995	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.992	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.873	cis-regulatory region sequence-specific DNA binding
GO:0001227	0.463	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.996	regulation of gene expression
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.988	regulation of DNA-templated transcription
GO:0048522	0.979	positive regulation of cellular process
GO:0009893	0.975	positive regulation of metabolic process
GO:0006357	0.968	regulation of transcription by RNA polymerase II
GO:0045935	0.967	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.959	positive regulation of RNA metabolic process
GO:0045893	0.953	positive regulation of DNA-templated transcription
GO:0045944	0.941	positive regulation of transcription by RNA polymerase II
GO:0009987	0.871	cellular process
GO:0071704	0.568	organic substance metabolic process
GO:0044238	0.533	primary metabolic process
GO:0006807	0.509	nitrogen compound metabolic process
GO:0043170	0.424	macromolecule metabolic process
GO:0044237	0.399	cellular metabolic process
GO:0048519	0.374	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.996	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]