StarFunc result for job id Q12802

User Input

>input (1400 residues)
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAP
GHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLD
QSGPPSGDVNSLDKKLVLAFRHLKLPTEWNVLGTDQSLHDAGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNQEGATPVSLALERGYHKLHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESDSHHEHPFPGDGCTGPIFKLMNIQQQLMKTNLKQMDSLMPL
MMTAQDPSSAPETDGQFLPCAPEPTDPQRLSSSEETESTQCCPGSPVAQTESPCDLSSIV
EEENTDRSCRKKNKGVERKGEEVEPAPIVDSGTVSDQDSCLQSLPDCGVKGTEGLSSCGN
RNEETGTKSSGMPTDQESLSSGDAVLQRDLVMEPGTAQYSSGGELGGISTTNVSTPDTAG
EMEHGLMNPDATVWKNVLQGGESTKERFENSNIGTAGASDVHVTSKPVDKISVPNCAPAA
SSLDGNKPAESSLAFSNEETSTEKTAETETSRSREESADAPVDQNSVVIPAAAKDKISDG
LEPYTLLAAGIGEAMSPSDLALLGLEEDVMPHQNSETNSSHAQSQKGKSSPICSTTGDDK
LCADSACQQNTVTSSGDLVAKLCDNIVSESESTTARQPSSQDPPDASHCEDPQAHTVTSD
PVRDTQERADFCPFKVVDNKGQRKDVKLDKPLTNMLEVVSHPHPVVPKMEKELVPDQAVI
SDSTFSLANSPGSESVTKDDALSFVPSQKEKGTATPELHTATDYRDGPDGNSNEPDTRPL
EDRAVGLSTSSTAAELQHGMGNTSLTGLGGEHEGPAPPAIPEALNIKGNTDSSLQSVGKA
TLALDSVLTEEGKLLVVSESSAAQEQDKDKAVTCSSIKENALSSGTLQEEQRTPPPGQDT
QQFHEKSISADCAKDKALQLSNSPGASSAFLKAETEHNKEVAPQVSLLTQGGAAQSLVPP
GASLATESRQEALGAEHNSSALLPCLLPDGSDGSDALNCSQPSPLDVGVKNTQSQGKTSA
CEVSGDVTVDVTGVNALQGMAEPRRENISHNTQDILIPNVLLSQEKNAVLGLPVALQDKA
VTDPQGVGTPEMIPLDWEKGKLEGADHSCTMGDAEEAQIDDEAHPVLLQPVAKELPTDME
LSAHDDGAPAGVREVMRAPPSGRERSTPSLPCMVSAQDAPLPKGADLIEEAASRIVDAVI
EQVKAAGALLTEGEACHMSLSSPELGPLTKGLESAFTEKVSTFPPGESLPMGSTPEEATG
SLAGCFAGREEPEKIILPVQGPEPAAEMPDVKAEDEVDFRASSISEEVAVGSIAATLKMK
QGPMTQAINRENWCTIEPCP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97433	0.196	0.165	5.265E-25	1693	0.124	0.103	P97433.pdb.gz	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
2	PDB:3ehqA	0.058	0.313	7.673E-3	182	0.020	0.154	3ehqA.pdb.gz
3	PDB:6vxkB	0.054	0.098	1.067E-2	747	0.009	0.017	6vxkB.pdb.gz
4	AFDB:Q9BYP7	0.067	0.057	1.201E-2	1800	0.146	0.113	Q9BYP7.pdb.gz	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
5	AFDB:Q80XP9	0.044	0.039	1.269E-2	1757	0.152	0.121	Q80XP9.pdb.gz	WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus OX=10090 GN=Wnk3 PE=1 SV=3
6	AFDB:O94913	0.053	0.049	1.496E-2	1555	0.131	0.118	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
7	PDB:1bd8A	0.060	0.393	3.206E-2	156	0.017	0.154	1bd8A.pdb.gz
8	PDB:4v96AA	0.056	0.237	5.260E-2	299	0.022	0.104	4v96AA.pdb.gz
9	AFDB:Q54DW1	0.047	0.041	5.918E-2	1736	0.105	0.085	Q54DW1.pdb.gz	Q54DW1_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=docC PE=3 SV=1
10	PDB:4hh4C	0.028	0.118	6.555E-2	256	0.009	0.047	4hh4C.pdb.gz	Structure and possible mechanism of the CcbJ methyltransferase from Streptomyces caelestis.
11	AFDB:F1MAL5	0.043	0.046	7.792E-2	1327	0.134	0.142	F1MAL5.pdb.gz	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2
12	PDB:6zgaB	0.042	0.064	8.629E-2	786	0.014	0.024	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
13	AFDB:Q8WXD9	0.057	0.056	9.709E-2	1431	0.128	0.125	Q8WXD9.pdb.gz	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
14	PDB:1m2vA	0.042	0.064	1.018E-1	705	0.019	0.038	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
15	PDB:1rowA	0.052	0.425	1.136E-1	107	0.006	0.084	1rowA.pdb.gz
16	PDB:6mhvA	0.058	0.127	1.200E-1	613	0.015	0.034	6mhvA.pdb.gz
17	AFDB:P70587	0.034	0.033	1.210E-1	1490	0.128	0.120	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
18	PDB:3v99B	0.038	0.073	1.268E-1	639	0.011	0.023	3v99B.pdb.gz	Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.
19	AFDB:Q8IDK6	0.034	0.028	1.278E-1	1807	0.087	0.068	Q8IDK6.pdb.gz	Q8IDK6_PLAF7 Tyrosine kinase-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1349300 PE=4 SV=1
20	AFDB:Q8BRB7	0.057	0.052	1.351E-1	1872	0.130	0.097	Q8BRB7.pdb.gz	KAT6B_MOUSE Histone acetyltransferase KAT6B OS=Mus musculus OX=10090 GN=Kat6b PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q394	0.0	1421	2776	0.592	0.299	AKP13_MOUSE A-kinase anchor protein 13 OS=Mus musculus OX=10090 GN=Akap13 PE=1 SV=1
2	F1M3G7	0.0	1363	2760	0.585	0.297	AKP13_RAT A-kinase anchor protein 13 OS=Rattus norvegicus OX=10116 GN=Akap13 PE=1 SV=2
3	Q12802	0.0	2875	2813	1.000	0.498	AKP13_HUMAN A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2
4	Q8N1W1	2.39e-32	140	1705	0.056	0.046	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
5	P97433	4.11e-26	119	1700	0.054	0.045	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
6	A0A0B4KFZ6	2.02e-06	55.1	1029	0.027	0.037	A0A0B4KFZ6_DROME Stumps, isoform D OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=1
7	Q9VFH9	2.20e-06	55.1	1012	0.027	0.038	Q9VFH9_DROME Stumps, isoform B OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=1
8	O96757	2.36e-06	54.7	1012	0.027	0.038	O96757_DROME Dof protein OS=Drosophila melanogaster OX=7227 GN=stumps PE=1 SV=1
9	A0A0B4KGP0	2.41e-06	54.7	973	0.027	0.039	A0A0B4KGP0_DROME Stumps, isoform F OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=1
10	Q1WWH6	2.87e-06	54.7	1211	0.025	0.029	Q1WWH6_DROME RE42507p OS=Drosophila melanogaster OX=7227 GN=stumps PE=2 SV=1
11	Q9VFI0	3.00e-06	54.7	1220	0.027	0.031	Q9VFI0_DROME Stumps, isoform E OS=Drosophila melanogaster OX=7227 GN=stumps PE=4 SV=3
12	O96758	3.33e-06	54.3	1147	0.027	0.033	O96758_DROME Dof protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=stumps PE=2 SV=2
13	F6P6M2	7.55e-06	53.1	1753	0.026	0.021	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
14	Q6ZUJ8	1.62e-04	48.5	805	0.016	0.029	BCAP_HUMAN Phosphoinositide 3-kinase adapter protein 1 OS=Homo sapiens OX=9606 GN=PIK3AP1 PE=1 SV=2
15	Q9DDT2	1.86e-04	48.5	800	0.016	0.029	BCAP_CHICK Phosphoinositide 3-kinase adapter protein 1 OS=Gallus gallus OX=9031 GN=PIK3AP1 PE=1 SV=1
16	Q9EQ32	1.91e-04	48.5	811	0.016	0.028	BCAP_MOUSE Phosphoinositide 3-kinase adapter protein 1 OS=Mus musculus OX=10090 GN=Pik3ap1 PE=1 SV=1
17	A0A087WTD7	0.11	39.7	1429	0.009	0.009	A0A087WTD7_HUMAN A-kinase anchoring protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=1
18	A8MYJ1	0.11	39.7	1434	0.009	0.009	A8MYJ1_HUMAN A-kinase anchoring protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=3
19	Q8NDB2	0.19	38.5	785	0.015	0.027	BANK1_HUMAN B-cell scaffold protein with ankyrin repeats OS=Homo sapiens OX=9606 GN=BANK1 PE=1 SV=3
20	Q65XV2	0.20	38.5	450	0.025	0.078	XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica OX=39947 GN=XB3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10522 RII_binding_1	0.48	21.7	RII binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354718

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.999	Transforming protein RhoA
2	9606.ENSP00000333568	0.980	Serine/threonine-protein kinase D1
3	9606.ENSP00000265563	0.978	cAMP-dependent protein kinase type II-alpha regulatory subunit
4	9606.ENSP00000275364	0.974	Guanine nucleotide-binding protein subunit alpha-12
5	9606.ENSP00000265717	0.962	cAMP-dependent protein kinase type II-beta regulatory subunit
6	9606.ENSP00000381958	0.931	Kinase suppressor of Ras 1
7	9606.ENSP00000478212	0.922	A-kinase anchor protein 1, mitochondrial
8	9606.ENSP00000363553	0.915	Lysophosphatidic acid receptor 1
9	9606.ENSP00000359719	0.910	cAMP-dependent protein kinase catalytic subunit beta
10	9606.ENSP00000443256	0.906	Lysophosphatidic acid receptor 2
11	9606.ENSP00000366488	0.905	cAMP-dependent protein kinase catalytic subunit gamma
12	9606.ENSP00000395389	0.904	Lysophosphatidic acid receptor 3
13	9606.ENSP00000323867	0.901	5'-AMP-activated protein kinase subunit gamma-1
14	9606.ENSP00000343325	0.899	Serine/threonine-protein kinase N1
15	9606.ENSP00000357177	0.875	Rho guanine nucleotide exchange factor 11
16	9606.ENSP00000337261	0.850	Rho guanine nucleotide exchange factor 1
17	9606.ENSP00000400717	0.850	Guanine nucleotide-binding protein subunit alpha-13
18	9606.ENSP00000468057	0.833	Heat shock protein beta-6
19	9606.ENSP00000378207	0.823	A-kinase anchor protein 5
20	9606.ENSP00000320434	0.816	Alpha-catulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005078	1.000	MAP-kinase scaffold activity
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0051018	0.581	protein kinase A binding
GO:0019899	0.464	enzyme binding
GO:0051020	0.417	GTPase binding
GO:0031267	0.407	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0023052	0.969	signaling
GO:0009966	0.967	regulation of signal transduction
GO:0050896	0.965	response to stimulus
GO:0007165	0.962	signal transduction
GO:1902531	0.940	regulation of intracellular signal transduction
GO:0048518	0.930	positive regulation of biological process
GO:0007186	0.925	G protein-coupled receptor signaling pathway
GO:0051056	0.914	regulation of small GTPase mediated signal transduction
GO:0043122	0.870	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048522	0.845	positive regulation of cellular process
GO:1902533	0.826	positive regulation of intracellular signal transduction
GO:0046578	0.734	regulation of Ras protein signal transduction
GO:0035023	0.710	regulation of Rho protein signal transduction
GO:0043123	0.707	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051057	0.698	positive regulation of small GTPase mediated signal transduction
GO:0046579	0.655	positive regulation of Ras protein signal transduction
GO:0035025	0.654	positive regulation of Rho protein signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0071944	0.975	cell periphery
GO:0016020	0.972	membrane
GO:0005829	0.958	cytosol
GO:0005856	0.902	cytoskeleton
GO:0015629	0.873	actin cytoskeleton
GO:0043227	0.408	membrane-bounded organelle
GO:0005886	0.402	plasma membrane
GO:0043231	0.378	intracellular membrane-bounded organelle
GO:0005938	0.311	cell cortex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]