StarFunc result for job id Q12805

User Input

>input (493 residues)
MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVA
SAAAVAGPEMQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAG
THNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCS
PGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT
SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFRCY
PRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA
NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS
VLRLTIIVGPFSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35568	0.684	0.684	4.150E-83	493	0.931	0.931	O35568.pdb.gz	FBLN3_RAT EGF-containing fibulin-like extracellular matrix protein 1 OS=Rattus norvegicus OX=10116 GN=Efemp1 PE=1 SV=1
2	AFDB:A0A0S2Z3V1	0.409	0.487	7.688E-71	413	0.838	1.000	A0A0S2Z3V1.pdb.gz	A0A0S2Z3V1_HUMAN EGF containing fibulin-like extracellular matrix protein 1 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=EFEMP1 PE=1 SV=1
3	AFDB:B1WC21	0.464	0.352	5.258E-38	685	0.290	0.209	B1WC21.pdb.gz	B1WC21_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=2 SV=1
4	PDB:7q3nU	0.130	0.197	9.108E-7	292	0.124	0.209	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
5	AFDB:Q6R8J2	0.117	0.065	3.531E-4	977	0.156	0.079	Q6R8J2.pdb.gz	HEG_DANRE Protein HEG OS=Danio rerio OX=7955 GN=heg PE=1 SV=1
6	AFDB:Q54NE5	0.142	0.042	5.121E-3	1918	0.156	0.040	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
7	PDB:5ghuA	0.146	0.319	1.250E-2	201	0.034	0.085	5ghuA.pdb.gz
8	AFDB:P55066	0.139	0.058	1.560E-2	1268	0.134	0.052	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
9	PDB:4b0mM	0.144	0.300	1.652E-2	212	0.030	0.071	4b0mM.pdb.gz
10	PDB:4aizA	0.130	0.442	1.747E-2	107	0.026	0.121	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
11	PDB:4lk4A	0.100	0.144	2.183E-2	326	0.032	0.049	4lk4A.pdb.gz
12	PDB:1bd2D	0.140	0.309	4.504E-2	190	0.032	0.084	1bd2D.pdb.gz	Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.
13	PDB:2cd0A	0.127	0.414	5.035E-2	111	0.028	0.126	2cd0A.pdb.gz
14	PDB:5ir3A	0.125	0.397	5.323E-2	111	0.024	0.108	5ir3A.pdb.gz
15	AFDB:A0A1D5PNG2	0.119	0.075	7.426E-2	890	0.134	0.074	A0A1D5PNG2.pdb.gz
16	PDB:1rowA	0.098	0.320	7.436E-2	107	0.022	0.103	1rowA.pdb.gz
17	PDB:1kiuB	0.126	0.189	8.313E-2	279	0.022	0.039	1kiuB.pdb.gz	Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.
18	AFDB:E9Q4Y4	0.123	0.031	1.160E-1	2514	0.152	0.030	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
19	AFDB:A0A0A0MSA4	0.070	0.036	1.449E-1	1046	0.122	0.057	A0A0A0MSA4.pdb.gz	A0A0A0MSA4_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
20	AFDB:Q6WRI0	0.124	0.027	1.620E-1	2623	0.140	0.026	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35568	0.0	962	493	0.931	0.931	FBLN3_RAT EGF-containing fibulin-like extracellular matrix protein 1 OS=Rattus norvegicus OX=10116 GN=Efemp1 PE=1 SV=1
2	Q12805	0.0	1019	493	1.000	1.000	FBLN3_HUMAN EGF-containing fibulin-like extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=EFEMP1 PE=1 SV=2
3	Q8BPB5	0.0	972	493	0.945	0.945	FBLN3_MOUSE EGF-containing fibulin-like extracellular matrix protein 1 OS=Mus musculus OX=10090 GN=Efemp1 PE=1 SV=1
4	A0A0S2Z3V1	8.72e-174	496	413	0.495	0.591	A0A0S2Z3V1_HUMAN EGF containing fibulin-like extracellular matrix protein 1 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=EFEMP1 PE=1 SV=1
5	Q9WVJ9	5.15e-170	488	443	0.493	0.549	FBLN4_MOUSE EGF-containing fibulin-like extracellular matrix protein 2 OS=Mus musculus OX=10090 GN=Efemp2 PE=1 SV=1
6	O95967	1.15e-168	484	443	0.481	0.535	FBLN4_HUMAN EGF-containing fibulin-like extracellular matrix protein 2 OS=Homo sapiens OX=9606 GN=EFEMP2 PE=1 SV=3
7	Q9WVH9	1.51e-127	380	448	0.408	0.449	FBLN5_MOUSE Fibulin-5 OS=Mus musculus OX=10090 GN=Fbln5 PE=1 SV=1
8	Q9WVH8	2.19e-112	341	448	0.337	0.371	FBLN5_RAT Fibulin-5 OS=Rattus norvegicus OX=10116 GN=Fbln5 PE=2 SV=1
9	Q9UBX5	5.54e-112	340	448	0.339	0.373	FBLN5_HUMAN Fibulin-5 OS=Homo sapiens OX=9606 GN=FBLN5 PE=1 SV=1
10	P37889	4.94e-63	224	1221	0.300	0.121	FBLN2_MOUSE Fibulin-2 OS=Mus musculus OX=10090 GN=Fbln2 PE=1 SV=2
11	F1SPG5	1.65e-62	223	1221	0.296	0.120	F1SPG5_PIG Fibulin 2 OS=Sus scrofa OX=9823 GN=FBLN2 PE=1 SV=3
12	P98095	1.73e-59	214	1184	0.290	0.121	FBLN2_HUMAN Fibulin-2 OS=Homo sapiens OX=9606 GN=FBLN2 PE=1 SV=2
13	B1WC21	4.85e-58	205	685	0.312	0.225	B1WC21_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=2 SV=1
14	D3ZQ25	1.10e-53	193	655	0.290	0.218	D3ZQ25_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=3 SV=2
15	O42182	9.18e-49	180	681	0.320	0.232	FBLN1_DANRE Fibulin-1 OS=Danio rerio OX=7955 GN=fbln1 PE=2 SV=1
16	Q8NBH6	1.13e-48	179	638	0.323	0.249	Q8NBH6_HUMAN Fibulin-1 OS=Homo sapiens OX=9606 PE=2 SV=1
17	P23142	1.87e-48	179	703	0.323	0.226	FBLN1_HUMAN Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1 PE=1 SV=4
18	Q08879	3.38e-48	179	705	0.316	0.221	FBLN1_MOUSE Fibulin-1 OS=Mus musculus OX=10090 GN=Fbln1 PE=1 SV=2
19	A0A0G2JY81	5.02e-45	169	695	0.288	0.204	A0A0G2JY81_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=1 SV=1
20	O77469	3.67e-41	159	728	0.288	0.195	FBLN1_CAEEL Fibulin-1 OS=Caenorhabditis elegans OX=6239 GN=fbl-1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.7e-33	125.4	Complement Clr-like EGF-like
2	PF00008 EGF	0.0024	29.4	EGF-like domain
3	PF12947 EGF_3	3.7e-08	44.7	EGF domain
4	PF07645 EGF_CA	5e-46	166.0	Calcium-binding EGF domain
5	PF14670 FXa_inhibition	1.8e-05	36.3	Coagulation Factor Xa inhibitory site
6	PF12661 hEGF	2.6	20.0	Human growth factor-like EGF
7	PF12191 stn_TNFRSF12A	7.4e+02	11.8	Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003830897.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003821542.1	0.804	Metalloproteinase inhibitor 3
2	9597.XP_008964822.1	0.788	Lysine-specific histone demethylase 1A isoform X1
3	9597.XP_003826749.1	0.732	Protein-lysine 6-oxidase
4	9597.XP_008967087.1	0.723	Epidermal growth factor receptor
5	9597.NP_001276650.1	0.721	Ornithine decarboxylase antizyme 1
6	9597.XP_008949279.1	0.695	E3 ubiquitin-protein ligase NEURL1
7	9597.XP_008964864.1	0.695	E3 ubiquitin-protein ligase NEURL1B
8	9597.XP_003805721.1	0.653	Rho GTPase activating protein 6
9	9597.XP_003845996.1	0.616	Complement factor H
10	9597.XP_003812709.1	0.612	Vitronectin
11	9597.XP_008966793.1	0.601	Elastin
12	9597.XP_003826599.1	0.600	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
13	9597.XP_003828014.1	0.591	Cartilage intermediate layer protein
14	9597.XP_003817353.1	0.578	Extracellular matrix protein 1
15	9597.XP_008952321.1	0.554	Belongs to the MYST (SAS/MOZ) family.
16	9597.XP_008965372.1	0.548	Microfibrillar-associated protein 2 isoform X1
17	9597.XP_003808715.1	0.545	Microfibrillar-associated protein 5 isoform X1
18	9597.XP_003828337.1	0.538	BCL2 like 13
19	9597.XP_003815692.2	0.521	E3 ubiquitin-protein ligase MIB1
20	9597.XP_008957632.1	0.521	E3 ubiquitin-protein ligase MIB2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0032501	0.981	multicellular organismal process
GO:0048856	0.979	anatomical structure development
GO:0007275	0.967	multicellular organism development
GO:0048731	0.860	system development
GO:0048519	0.849	negative regulation of biological process
GO:0048513	0.827	animal organ development
GO:0048518	0.816	positive regulation of biological process
GO:0050896	0.787	response to stimulus
GO:0048523	0.721	negative regulation of cellular process
GO:0048522	0.719	positive regulation of cellular process
GO:0051239	0.689	regulation of multicellular organismal process
GO:0050793	0.672	regulation of developmental process
GO:0042127	0.665	regulation of cell population proliferation
GO:0048880	0.637	sensory system development
GO:0051128	0.605	regulation of cellular component organization
GO:0008152	0.599	metabolic process
GO:0045595	0.587	regulation of cell differentiation
GO:0019222	0.579	regulation of metabolic process
GO:0051716	0.562	cellular response to stimulus
GO:0071840	0.483	cellular component organization or biogenesis
GO:0060255	0.471	regulation of macromolecule metabolic process
GO:0051171	0.467	regulation of nitrogen compound metabolic process
GO:0080090	0.465	regulation of primary metabolic process
GO:0031323	0.461	regulation of cellular metabolic process
GO:0071704	0.454	organic substance metabolic process
GO:0016043	0.438	cellular component organization
GO:0044238	0.437	primary metabolic process
GO:0009653	0.405	anatomical structure morphogenesis
GO:0048583	0.374	regulation of response to stimulus
GO:0040012	0.356	regulation of locomotion
GO:0006807	0.321	nitrogen compound metabolic process
GO:0007154	0.308	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0043227	0.996	membrane-bounded organelle
GO:0005615	0.992	extracellular space
GO:0005622	0.968	intracellular anatomical structure
GO:0005737	0.929	cytoplasm
GO:0070062	0.927	extracellular exosome
GO:0043231	0.767	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]