StarFunc result for job id Q12809

User Input

>input (1159 residues)
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSV
RSGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSP
PRSAPGQLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPP
RHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIA
PKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIY
TAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANE
EVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLD
RYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSS
GLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVS
AIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGF
PECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALY
FISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLE
VLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTE
QPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSS
PRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTP
SLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSA
VTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPG
QLGALTSQPLHRHGSDPGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B3DJX4	0.576	0.563	0.000	1186	0.582	0.568	B3DJX4.pdb.gz
2	AFDB:O08962	0.652	0.650	0.000	1163	0.959	0.956	O08962.pdb.gz	KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus OX=10116 GN=Kcnh2 PE=1 SV=1
3	AFDB:Q9NS40	0.583	0.565	0.000	1196	0.587	0.569	Q9NS40.pdb.gz	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2
4	AFDB:Q9H252	0.551	0.639	2.807E-100	994	0.544	0.635	Q9H252.pdb.gz	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
5	AFDB:O54853	0.532	0.645	3.167E-97	950	0.543	0.662	O54853.pdb.gz	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
6	PDB:7rhsA	0.343	0.820	6.855E-28	456	0.097	0.246	7rhsA.pdb.gz
7	PDB:7n15A	0.329	0.682	3.383E-26	520	0.096	0.213	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
8	PDB:7wswA	0.322	0.722	3.383E-26	472	0.098	0.242	7wswA.pdb.gz
9	PDB:7rhsD	0.331	0.809	3.605E-24	441	0.080	0.211	7rhsD.pdb.gz
10	PDB:7calA	0.327	0.782	6.338E-24	444	0.085	0.221	7calA.pdb.gz
11	PDB:7o4hB	0.326	0.734	1.606E-22	468	0.091	0.224	7o4hB.pdb.gz
12	PDB:7xufA	0.316	0.688	6.416E-22	476	0.090	0.218	7xufA.pdb.gz
13	PDB:7o4hD	0.234	0.635	1.125E-13	383	0.052	0.157	7o4hD.pdb.gz
14	PDB:6eo1A	0.120	0.283	5.653E-9	355	0.060	0.197	6eo1A.pdb.gz
15	PDB:4byyA	0.096	0.457	8.573E-8	226	0.023	0.119	4byyA.pdb.gz
16	AFDB:P79832	0.084	0.131	1.193E-4	723	0.049	0.079	P79832.pdb.gz	ARNT_ONCMY Aryl hydrocarbon receptor nuclear translocator OS=Oncorhynchus mykiss OX=8022 GN=arnt PE=1 SV=1
17	AFDB:Q8NEC5	0.098	0.130	1.256E-4	780	0.075	0.112	Q8NEC5.pdb.gz	CTSR1_HUMAN Cation channel sperm-associated protein 1 OS=Homo sapiens OX=9606 GN=CATSPER1 PE=1 SV=3
18	AFDB:E7FDK6	0.091	0.140	1.623E-4	731	0.047	0.074	E7FDK6.pdb.gz
19	AFDB:Q98SN3	0.091	0.126	2.098E-4	805	0.053	0.077	Q98SN3.pdb.gz	Q98SN3_CHICK Aryl hydrocarbon receptor nuclear translocator OS=Gallus gallus OX=9031 PE=2 SV=1
20	AFDB:P58390	0.143	0.185	2.576E-4	839	0.097	0.135	P58390.pdb.gz	KCNN2_MOUSE Small conductance calcium-activated potassium channel protein 2 OS=Mus musculus OX=10090 GN=Kcnn2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EFJ9	0.0	735	829	0.349	0.487	UN103_CAEEL Potassium voltage-gated channel unc-103 OS=Caenorhabditis elegans OX=6239 GN=unc-103 PE=1 SV=1
2	O08962	0.0	2206	1163	0.959	0.956	KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus OX=10116 GN=Kcnh2 PE=1 SV=1
3	O35219	0.0	2182	1162	0.963	0.960	KCNH2_MOUSE Potassium voltage-gated channel subfamily H member 2 OS=Mus musculus OX=10090 GN=Kcnh2 PE=1 SV=2
4	O54852	0.0	1300	1195	0.596	0.578	KCNH7_RAT Potassium voltage-gated channel subfamily H member 7 OS=Rattus norvegicus OX=10116 GN=Kcnh7 PE=1 SV=1
5	O54853	0.0	945	950	0.392	0.478	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
6	Q12809	0.0	2375	1159	1.000	1.000	KCNH2_HUMAN Potassium voltage-gated channel subfamily H member 2 OS=Homo sapiens OX=9606 GN=KCNH2 PE=1 SV=1
7	Q7JPB9	0.0	748	855	0.305	0.414	Q7JPB9_DROME GH12235p OS=Drosophila melanogaster OX=7227 GN=sei PE=2 SV=1
8	Q8JH78	0.0	1208	1186	0.595	0.582	Q8JH78_DANRE Erg K+ channel OS=Danio rerio OX=7955 GN=erg PE=2 SV=1
9	Q9H252	0.0	962	994	0.469	0.547	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
10	Q9NS40	0.0	1274	1196	0.588	0.569	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2
11	K4EHU2	1.39e-158	499	956	0.211	0.255	K4EHU2_DANRE Potassium voltage-gated channel subfamily H member 1b OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
12	Q63472	8.64e-155	489	962	0.207	0.249	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
13	Q108P3	5.81e-154	486	959	0.204	0.247	Q108P3_DANRE Potassium voltage-gated channel subfamily H member 1 OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
14	Q02280	2.32e-153	491	1174	0.217	0.214	KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster OX=7227 GN=eag PE=1 SV=2
15	Q9EPI9	1.73e-151	481	988	0.205	0.241	KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus OX=10116 GN=Kcnh5 PE=2 SV=1
16	Q8NCM2	2.33e-151	481	988	0.205	0.241	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
17	O95259	6.12e-151	479	989	0.208	0.244	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
18	Q60603	1.23e-150	479	989	0.208	0.244	KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus OX=10090 GN=Kcnh1 PE=1 SV=2
19	O18965	1.52e-150	478	987	0.208	0.244	KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus OX=9913 GN=KCNH1 PE=2 SV=2
20	Q96L42	2.96e-145	468	1107	0.209	0.219	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	7.7e-08	43.6	Cyclic nucleotide-binding domain
2	PF00520 Ion_trans	6.1e-32	122.4	Ion transport protein
3	PF07885 Ion_trans_2	6.3e-08	43.8	Ion channel
4	PF00989 PAS	7e-05	34.2	PAS fold
5	PF08447 PAS_3	0.0048	28.5	PAS fold
6	PF08448 PAS_4	0.3	22.7	PAS fold
7	PF13188 PAS_8	25	16.3	PAS domain
8	PF13426 PAS_9	5e-13	60.6	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262186

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290310	0.995	Potassium voltage-gated channel subfamily E member 2
2	9606.ENSP00000337255	0.993	Potassium voltage-gated channel subfamily E member 1
3	9606.ENSP00000155840	0.987	Potassium voltage-gated channel subfamily KQT member 1
4	9606.ENSP00000335153	0.982	Heat shock protein HSP 90-alpha
5	9606.ENSP00000410257	0.960	Sodium channel protein type 5 subunit alpha
6	9606.ENSP00000282397	0.949	Vascular endothelial growth factor receptor 1
7	9606.ENSP00000319591	0.920	Potassium voltage-gated channel subfamily D member 3
8	9606.ENSP00000252321	0.903	Potassium voltage-gated channel subfamily A member 5
9	9606.ENSP00000243457	0.883	Inward rectifier potassium channel 2
10	9606.ENSP00000302961	0.875	Heat shock protein family A member 4
11	9606.ENSP00000310557	0.870	Potassium voltage-gated channel subfamily E member 3
12	9606.ENSP00000361173	0.864	Potassium voltage-gated channel subfamily E regulatory beta subunit 5
13	9606.ENSP00000433109	0.863	Potassium voltage-gated channel subfamily A member 2
14	9606.ENSP00000310120	0.861	Putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
15	9606.ENSP00000463533	0.861	Potassium voltage-gated channel subfamily H member 6
16	9606.ENSP00000328511	0.857	Potassium voltage-gated channel subfamily A member 4
17	9606.ENSP00000358784	0.854	Potassium voltage-gated channel subfamily A member 3
18	9606.ENSP00000265969	0.852	Potassium voltage-gated channel subfamily C member 1
19	9606.ENSP00000352035	0.848	Potassium voltage-gated channel subfamily KQT member 2
20	9606.ENSP00000266376	0.846	Voltage-dependent L-type calcium channel subunit alpha-1C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005242	0.998	inward rectifier potassium channel activity
GO:0005515	0.997	protein binding
GO:0044877	0.666	protein-containing complex binding
GO:0097110	0.344	scaffold protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050789	0.990	regulation of biological process
GO:0065008	0.985	regulation of biological quality
GO:0006813	0.985	potassium ion transport
GO:0042391	0.983	regulation of membrane potential
GO:0044057	0.970	regulation of system process
GO:0008016	0.963	regulation of heart contraction
GO:0071805	0.935	potassium ion transmembrane transport
GO:0032501	0.932	multicellular organismal process
GO:0061337	0.896	cardiac conduction
GO:0002027	0.890	regulation of heart rate
GO:0050794	0.808	regulation of cellular process
GO:0048518	0.454	positive regulation of biological process
GO:0032879	0.420	regulation of localization
GO:0086001	0.338	cardiac muscle cell action potential
GO:0060047	0.334	heart contraction
GO:0006936	0.330	muscle contraction
GO:0050896	0.325	response to stimulus
GO:0051049	0.308	regulation of transport
GO:0019222	0.307	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.993	protein-containing complex
GO:0098796	0.951	membrane protein complex
GO:0034702	0.935	ion channel complex
GO:0098797	0.934	plasma membrane protein complex
GO:0034703	0.934	cation channel complex
GO:0005622	0.845	intracellular anatomical structure
GO:0034705	0.838	potassium channel complex
GO:0005737	0.825	cytoplasm
GO:0008076	0.822	voltage-gated potassium channel complex
GO:0043226	0.507	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]