StarFunc result for job id Q12816

User Input

>input (1431 residues)
MDRRNDYGYRVPLFQGPLPPPGSLGLPFPPDIQTETTEEDSVLLMHTLLAATKDSLAMDP
PVVNRPKKSKTKKAPIKTITKAAPAAPPVPAANEIATNKPKITWQALNLPVITQISQALP
TTEVTNTQASSVTAQPKKANKMKRVTAKAAQGSQSPTGHEGGTIQLKSPLQVLKLPVISQ
NIHAPIANESASSQALITSIKPKKASKAKKAANKAIASATEVSLAATATHTATTQGQITN
ETASIHTTAASIRTKKASKARKTIAKVINTDTEHIEALNVTDAATRQIEASVVAIRPKKS
KGKKAASRGPNSVSEISEAPLATQIVTNQALAATLRVKRGSRARKAATKARATESQTPNA
DQGAQAKIASAQTNVSALETQVAAAVQALADDYLAQLSLEPTTRTRGKRNRKSKHLNGDE
RSGSNYRRIPWGRRPAPPRDVAILQERANKLVKYLLVKDQTKIPIKRSDMLRDVIQEYDE
YFPEIIERASYTLEKMFRVNLKEIDKQSSLYILISTQESSAGILGTTKDTPKLGLLMVIL
SVIFMNGNKASEAVIWEVLRKLGLRPGVRHSLFGEVRKLITDEFVKQKYLEYKRVPNSRP
PEYEFFWGLRSYHETSKMKVLKFACRVQKKDPKDWAVQYREAVEMEVQAAAVAVAEAEAR
AEARAQMGIGEEAVAGPWNWDDMDIDCLTREELGDDAQAWSRFSFEIEARAQENADASTN
VNFSRGASTRAGFSDGASISFNGAPSSSGGFSGGPGITFGVAPSTSASFSNTASISFGGT
LSTSSSFSSAASISFGCAHSTSTSFSSEASISFGGMPCTSASFSGGVSSSFSGPLSTSAT
FSGGASSGFGGTLSTTAGFSGVLSTSTSFGSAPTTSTVFSSALSTSTGFGGILSTSVCFG
GSPSSSGSFGGTLSTSICFGGSPCTSTGFGGTLSTSVSFGGSSSTSANFGGTLSTSICFD
GSPSTGAGFGGALNTSASFGSVLNTSTGFGGAMSTSADFGGTLSTSVCFGGSPGTSVSFG
SALNTNAGYGGAVSTNTDFGGTLSTSVCFGGSPSTSAGFGGALNTNASFGCAVSTSASFS
GAVSTSACFSGAPITNPGFGGAFSTSAGFGGALSTAADFGGTPSNSIGFGAAPSTSVSFG
GAHGTSLCFGGAPSTSLCFGSASNTNLCFGGPPSTSACFSGATSPSFCDGPSTSTGFSFG
NGLSTNAGFGGGLNTSAGFGGGLGTSAGFSGGLSTSSGFDGGLGTSAGFGGGPGTSTGFG
GGLGTSAGFSGGLGTSAGFGGGLVTSDGFGGGLGTNASFGSTLGTSAGFSGGLSTSDGFG
SRPNASFDRGLSTIIGFGSGSNTSTGFTGEPSTSTGFSSGPSSIVGFSGGPSTGVGFCSG
PSTSGFSGGPSTGAGFGGGPNTGAGFGGGPSTSAGFGSGAASLGACGFSYG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12816	1.000	1.000	0.000	1431	1.000	1.000	Q12816.pdb.gz	TROP_HUMAN Trophinin OS=Homo sapiens OX=9606 GN=TRO PE=1 SV=3
2	AFDB:E9Q1Q4	0.169	0.781	4.311E-29	296	0.161	0.780	E9Q1Q4.pdb.gz	E9Q1Q4_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
3	AFDB:Q9Y5V3	0.186	0.336	2.542E-25	778	0.188	0.346	Q9Y5V3.pdb.gz	MAGD1_HUMAN Melanoma-associated antigen D1 OS=Homo sapiens OX=9606 GN=MAGED1 PE=1 SV=3
4	AFDB:Q9ES73	0.181	0.329	2.656E-25	775	0.190	0.351	Q9ES73.pdb.gz	MAGD1_RAT Melanoma-associated antigen D1 OS=Rattus norvegicus OX=10116 GN=Maged1 PE=1 SV=3
5	AFDB:Q9UJ55	0.141	0.161	7.091E-18	1249	0.140	0.160	Q9UJ55.pdb.gz	MAGL2_HUMAN MAGE-like protein 2 OS=Homo sapiens OX=9606 GN=MAGEL2 PE=1 SV=2
6	AFDB:Q9HCI5	0.141	0.206	1.638E-17	957	0.119	0.179	Q9HCI5.pdb.gz	MAGE1_HUMAN Melanoma-associated antigen E1 OS=Homo sapiens OX=9606 GN=MAGEE1 PE=1 SV=2
7	AFDB:Q9QZ04	0.148	0.165	2.518E-16	1284	0.107	0.119	Q9QZ04.pdb.gz	MAGL2_MOUSE MAGE-like protein 2 OS=Mus musculus OX=10090 GN=Magel2 PE=1 SV=2
8	AFDB:Q9HDY9	0.042	0.049	3.549E-7	1082	0.114	0.151	Q9HDY9.pdb.gz	MAM3_SCHPO M cell-type agglutination protein mam3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mam3 PE=3 SV=2
9	PDB:7qcdE	0.129	0.628	6.323E-5	261	0.029	0.157	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
10	AFDB:Q28139	0.066	0.072	7.346E-5	1216	0.091	0.107	Q28139.pdb.gz	NCKX1_BOVIN Sodium/potassium/calcium exchanger 1 OS=Bos taurus OX=9913 GN=SLC24A1 PE=1 SV=2
11	PDB:7tveF	0.125	0.591	7.882E-5	270	0.027	0.144	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
12	AFDB:P47179	0.047	0.051	1.193E-4	1161	0.094	0.115	P47179.pdb.gz	DAN4_YEAST Cell wall protein DAN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAN4 PE=2 SV=1
13	PDB:7d58O	0.043	0.107	9.511E-2	490	0.019	0.055	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
14	PDB:1u5tA	0.065	0.274	2.012E-1	213	0.017	0.113	1u5tA.pdb.gz
15	PDB:3cuqA	0.067	0.275	2.862E-1	219	0.010	0.068	3cuqA.pdb.gz
16	PDB:1ldjA	0.042	0.076	3.267E-1	725	0.020	0.039	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
17	PDB:5hs7A	0.051	0.424	4.072E-1	102	0.013	0.186	5hs7A.pdb.gz
18	PDB:6hivBN	0.051	0.219	4.857E-1	214	0.018	0.121	6hivBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:6hixBN	0.049	0.219	6.328E-1	214	0.020	0.131	6hixBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:7jgrB	0.045	0.204	6.328E-1	290	0.013	0.062	7jgrB.pdb.gz	Structural mechanism for replication origin binding and remodeling by a metazoan origin recognition complex and its co-loader Cdc6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q098	0.0	652	838	0.217	0.371	E9Q098_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
2	E9Q160	0.0	605	802	0.204	0.364	E9Q160_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
3	E9Q886	0.0	704	972	0.253	0.372	E9Q886_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
4	G5E9N2	0.0	1383	681	0.463	0.972	G5E9N2_HUMAN Trophinin OS=Homo sapiens OX=9606 GN=TRO PE=1 SV=1
5	Q12816	0.0	2818	1431	1.000	1.000	TROP_HUMAN Trophinin OS=Homo sapiens OX=9606 GN=TRO PE=1 SV=3
6	Q6DIC6	0.0	1028	2087	0.528	0.362	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
7	Q80TJ5	0.0	1032	1736	0.508	0.419	Q80TJ5_MOUSE MKIAA1114 protein (Fragment) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
8	Q99NC2	0.0	699	804	0.259	0.461	Q99NC2_MOUSE MAGE-necdin/trophinin complex (Magphinin) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
9	Q99PB3	0.0	1040	1987	0.535	0.386	Q99PB3_MOUSE Mage-d3 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
10	Q99PH6	0.0	604	795	0.204	0.367	Q99PH6_MOUSE Magphinin-gamma OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
11	Q99PH7	0.0	650	831	0.217	0.374	Q99PH7_MOUSE Magphinin-beta 2 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
12	Q99PM5	0.0	704	906	0.253	0.400	Q99PM5_MOUSE Magphinin-alpha OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
13	Q99PW2	0.0	704	965	0.259	0.384	Q99PW2_MOUSE Trophinin-2 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
14	Q8BSK0	3.07e-156	490	689	0.238	0.493	Q8BSK0_MOUSE Trophinin (Fragment) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
15	E9Q1Q4	5.03e-155	472	296	0.151	0.730	E9Q1Q4_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
16	Q99PM6	4.37e-152	495	1198	0.264	0.316	Q99PM6_MOUSE Cell adhesion protein trophinin OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
17	Q96JG8	1.67e-130	423	741	0.147	0.283	MAGD4_HUMAN Melanoma-associated antigen D4 OS=Homo sapiens OX=9606 GN=MAGED4 PE=1 SV=3
18	Q5H907	1.86e-130	416	521	0.171	0.468	Q5H907_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=1
19	Q9UNF1	8.14e-126	406	606	0.143	0.337	MAGD2_HUMAN Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
20	Q5H909	1.01e-125	405	588	0.143	0.347	Q5H909_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01454 MAGE	2e-16	71.9	MAGE homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000173898

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230340	0.992	Bystin
2	9606.ENSP00000257909	0.991	Tastin
3	9606.ENSP00000342235	0.671	Receptor tyrosine-protein kinase erbB-4
4	9606.ENSP00000378217	0.582	Protein kinase C delta type
5	9606.ENSP00000369757	0.537	40S ribosomal protein S6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.958	cellular process
GO:0050794	0.926	regulation of cellular process
GO:0032502	0.745	developmental process
GO:0007155	0.711	cell adhesion
GO:0032501	0.694	multicellular organismal process
GO:0044703	0.630	multi-organism reproductive process
GO:0044706	0.627	multi-multicellular organism process
GO:0048856	0.570	anatomical structure development
GO:0007275	0.493	multicellular organism development
GO:0007565	0.482	female pregnancy
GO:0007156	0.477	homophilic cell adhesion via plasma membrane adhesion molecules
GO:0048523	0.458	negative regulation of cellular process
GO:0007566	0.358	embryo implantation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005886	0.988	plasma membrane
GO:0005634	0.983	nucleus
GO:0070013	0.961	intracellular organelle lumen
GO:0031981	0.952	nuclear lumen
GO:0005737	0.950	cytoplasm
GO:0005654	0.920	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]