StarFunc result for job id Q12824

User Input

>input (385 residues)
MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEER
KKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYL
REQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA
SQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASA
IRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSE
LGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAE
MEKKIRDQDRNTRRMRRLANTAPAW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5E975	0.915	0.895	1.705E-68	394	0.974	0.952	G5E975.pdb.gz	G5E975_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens OX=9606 GN=SMARCB1 PE=1 SV=1
2	AFDB:Q24090	0.637	0.661	6.259E-52	370	0.642	0.668	Q24090.pdb.gz	Q24090_DROME GH08712p OS=Drosophila melanogaster OX=7227 GN=Snr1 PE=1 SV=2
3	AFDB:Q21831	0.747	0.754	3.119E-45	381	0.506	0.512	Q21831.pdb.gz	Q21831_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Caenorhabditis elegans OX=6239 GN=snfc-5 PE=1 SV=1
4	PDB:6lthM	0.643	0.944	9.191E-42	259	0.665	0.988	6lthM.pdb.gz	Structure of nucleosome-bound human BAF complex.
5	PDB:7vdvV	0.577	0.914	3.309E-39	238	0.618	1.000	7vdvV.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
6	AFDB:Q09699	0.497	0.308	2.581E-18	632	0.216	0.131	Q09699.pdb.gz	SNF5_SCHPO SWI/SNF chromatin-remodeling complex subunit snf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf5 PE=1 SV=1
7	AFDB:A0A1D8PEB6	0.522	0.569	3.897E-18	352	0.213	0.233	A0A1D8PEB6.pdb.gz	A0A1D8PEB6_CANAL Chromatin structure-remodeling complex subunit SFH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SFH1 PE=3 SV=1
8	AFDB:Q9USM3	0.491	0.455	1.600E-17	418	0.197	0.182	Q9USM3.pdb.gz	SFH1_SCHPO Chromatin structure-remodeling complex subunit sfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfh1 PE=1 SV=1
9	AFDB:P18480	0.486	0.217	2.278E-17	905	0.221	0.094	P18480.pdb.gz	SNF5_YEAST SWI/SNF chromatin-remodeling complex subunit SNF5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF5 PE=1 SV=3
10	AFDB:Q06168	0.506	0.460	1.896E-16	426	0.184	0.167	Q06168.pdb.gz	SFH1_YEAST Chromatin structure-remodeling complex subunit SFH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFH1 PE=1 SV=1
11	AFDB:A0A1D8PJZ6	0.469	0.269	1.578E-15	696	0.197	0.109	A0A1D8PJZ6.pdb.gz	A0A1D8PJZ6_CANAL Snf5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF5 PE=3 SV=1
12	PDB:7c4jF	0.472	0.475	2.210E-15	383	0.195	0.196	7c4jF.pdb.gz
13	PDB:6v8oQ	0.431	0.610	1.209E-13	264	0.153	0.223	6v8oQ.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
14	AFDB:F4J581	0.415	0.642	1.751E-13	242	0.158	0.252	F4J581.pdb.gz	F4J581_ARATH Transcription regulatory protein SNF5, putative (BSH) OS=Arabidopsis thaliana OX=3702 GN=BSH PE=1 SV=1
15	PDB:6tdaK	0.404	0.637	1.342E-11	235	0.158	0.260	6tdaK.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
16	PDB:3c7nA	0.089	0.058	3.208E-1	649	0.070	0.042	3c7nA.pdb.gz	Structure of the Hsp110:Hsc70 nucleotide exchange machine
17	PDB:7krwA	0.108	0.078	3.608E-1	608	0.094	0.059	7krwA.pdb.gz	Conformational equilibria in allosteric control of Hsp70 chaperones.
18	PDB:2qxlB	0.106	0.074	4.059E-1	625	0.073	0.045	2qxlB.pdb.gz	Insights into hsp70 chaperone activity from a crystal structure of the yeast hsp110 Sse1.
19	PDB:6sr6C	0.101	0.082	4.305E-1	524	0.096	0.071	6sr6C.pdb.gz	The ribosome-associated complex RAC serves in a relay that directs nascent chains to Ssb.
20	PDB:5dxhD	0.100	0.050	5.778E-1	981	0.070	0.028	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AVW5	0.0	742	368	0.922	0.965	A0A8I6AVW5_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Rattus norvegicus OX=10116 GN=Smarcb1 PE=1 SV=1
2	A0A8J8YH81	0.0	771	408	0.979	0.924	A0A8J8YH81_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Rattus norvegicus OX=10116 GN=Smarcb1 PE=1 SV=1
3	G5E975	0.0	766	394	0.977	0.954	G5E975_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens OX=9606 GN=SMARCB1 PE=1 SV=1
4	Q12824	0.0	807	385	1.000	1.000	SNF5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens OX=9606 GN=SMARCB1 PE=1 SV=2
5	Q24090	0.0	518	370	0.655	0.681	Q24090_DROME GH08712p OS=Drosophila melanogaster OX=7227 GN=Snr1 PE=1 SV=2
6	Q4KLI0	0.0	781	376	0.977	1.000	Q4KLI0_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Rattus norvegicus OX=10116 GN=Smarcb1 PE=1 SV=1
7	Q9Z0H3	0.0	807	385	1.000	1.000	SNF5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Mus musculus OX=10090 GN=Smarcb1 PE=1 SV=1
8	C9JTA6	1.17e-167	470	248	0.597	0.927	C9JTA6_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCB1 PE=1 SV=2
9	Q21831	7.86e-129	377	381	0.509	0.514	Q21831_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Caenorhabditis elegans OX=6239 GN=snfc-5 PE=1 SV=1
10	A0A1D8PEB6	1.19e-31	124	352	0.236	0.259	A0A1D8PEB6_CANAL Chromatin structure-remodeling complex subunit SFH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SFH1 PE=3 SV=1
11	Q09699	3.68e-30	124	632	0.205	0.125	SNF5_SCHPO SWI/SNF chromatin-remodeling complex subunit snf5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snf5 PE=1 SV=1
12	Q9USM3	2.02e-28	117	418	0.184	0.170	SFH1_SCHPO Chromatin structure-remodeling complex subunit sfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfh1 PE=1 SV=1
13	Q06168	3.89e-28	116	426	0.174	0.157	SFH1_YEAST Chromatin structure-remodeling complex subunit SFH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFH1 PE=1 SV=1
14	A0A1D8PJZ6	2.53e-25	110	696	0.195	0.108	A0A1D8PJZ6_CANAL Snf5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF5 PE=3 SV=1
15	P18480	1.04e-24	108	905	0.164	0.070	SNF5_YEAST SWI/SNF chromatin-remodeling complex subunit SNF5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF5 PE=1 SV=3
16	F4J581	2.45e-20	91.3	242	0.135	0.215	F4J581_ARATH Transcription regulatory protein SNF5, putative (BSH) OS=Arabidopsis thaliana OX=3702 GN=BSH PE=1 SV=1
17	L8B1Q7	4.2	32.0	343	0.034	0.038	L8B1Q7_9ALPH Envelope glycoprotein K OS=Equid alphaherpesvirus 1 OX=10326 GN=ORF6 PE=1 SV=1
18	Q8I5T4	5.0	32.0	758	0.049	0.025	Q8I5T4_PLAF7 DNA helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211700 PE=3 SV=1
19	F4KHD5	5.9	31.6	2889	0.068	0.009	F4KHD5_ARATH A-kinase anchor-like protein OS=Arabidopsis thaliana OX=3702 GN=RBB1 PE=1 SV=1
20	Q8L7S6	6.9	31.2	535	0.047	0.034	HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana OX=3702 GN=HEXO3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07914 DUF1679	17	15.8	Uncharacterized oxidoreductase dhs-27
2	PF04855 SNF5	7.9e-53	191.2	SNF5 / SMARCB1 / INI1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008838842.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008828953.1	0.999	SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 1
2	1026970.XP_008831773.1	0.999	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
3	1026970.XP_008835051.1	0.999	AT-rich interactive domain-containing protein 1A
4	1026970.XP_008839537.1	0.999	AT-rich interaction domain 2
5	1026970.XP_008846929.1	0.999	SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2
6	1026970.XP_008846986.1	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
7	1026970.XP_008839915.1	0.997	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
8	1026970.XP_008833403.1	0.996	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 isoform X1
9	1026970.XP_008851540.1	0.996	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon
10	1026970.XP_008830563.1	0.995	Actin like 6B
11	1026970.XP_008836882.1	0.995	Actin-like protein 6A isoform X1
12	1026970.XP_008837880.1	0.995	AT-rich interactive domain-containing protein 1B
13	1026970.XP_008848025.1	0.995	Double PHD fingers 3
14	1026970.XP_008820393.1	0.994	Double PHD fingers 2
15	1026970.XP_008841611.1	0.994	PHD finger protein 10 isoform X1
16	1026970.XP_008844807.1	0.993	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
17	1026970.XP_008845458.1	0.993	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
18	1026970.XP_008850021.1	0.992	Polybromo 1
19	1026970.XP_008852115.1	0.990	Double PHD fingers 1
20	1026970.XP_008835077.1	0.985	Myb like, SWIRM and MPN domains 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0030957	0.377	Tat protein binding
GO:1901363	0.341	heterocyclic compound binding
GO:0097159	0.341	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048519	0.959	negative regulation of biological process
GO:0048523	0.942	negative regulation of cellular process
GO:0019222	0.923	regulation of metabolic process
GO:0060255	0.914	regulation of macromolecule metabolic process
GO:0080090	0.890	regulation of primary metabolic process
GO:0051171	0.890	regulation of nitrogen compound metabolic process
GO:0031323	0.889	regulation of cellular metabolic process
GO:0010468	0.889	regulation of gene expression
GO:0048518	0.860	positive regulation of biological process
GO:0006355	0.799	regulation of DNA-templated transcription
GO:0016043	0.797	cellular component organization
GO:0048522	0.785	positive regulation of cellular process
GO:0009893	0.758	positive regulation of metabolic process
GO:0010604	0.754	positive regulation of macromolecule metabolic process
GO:0006357	0.751	regulation of transcription by RNA polymerase II
GO:0051173	0.735	positive regulation of nitrogen compound metabolic process
GO:0031325	0.698	positive regulation of cellular metabolic process
GO:0045935	0.681	positive regulation of nucleobase-containing compound metabolic process
GO:1903508	0.635	positive regulation of nucleic acid-templated transcription
GO:0045893	0.620	positive regulation of DNA-templated transcription
GO:0032502	0.525	developmental process
GO:0032501	0.524	multicellular organismal process
GO:0048856	0.523	anatomical structure development
GO:0007275	0.465	multicellular organism development
GO:0050896	0.434	response to stimulus
GO:0030154	0.306	cell differentiation
GO:0048731	0.300	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0000785	0.999	chromatin
GO:0070013	0.967	intracellular organelle lumen
GO:0031981	0.958	nuclear lumen
GO:0032991	0.950	protein-containing complex
GO:0005654	0.912	nucleoplasm
GO:0140513	0.838	nuclear protein-containing complex
GO:1902494	0.826	catalytic complex
GO:0070603	0.569	SWI/SNF superfamily-type complex
GO:0005737	0.375	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]