StarFunc result for job id Q12830

User Input

>input (1400 residues)
MRGRRGRPPKQPAAPAAERCAPAPPPPPPPPTSGPIGGLRSRHRGSSRGRWAAAQAEVAP
KTRLSSPRGGSSSRRKPPPPPPAPPSTSAPGRGGRGGGGGRTGGGGGGGHLARTTAARRA
VNKVVYDDHESEEEEEEEDMVSEEEEEEDGDAEETQDSEDDEEDEMEEDDDDSDYPEEME
DDDDDASYCTESSFRSHSTYSSTPGRRKPRVHRPRSPILEEKDIPPLEFPKSSEDLMVPN
EHIMNVIAIYEVLRNFGTVLRLSPFRFEDFCAALVSQEQCTLMAEMHVVLLKAVLREEDT
SNTTFGPADLKDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAEDYPYGPVENK
IKVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPP
LEEVPEDEWQCEVCVAHKVPGVTDCVAEIQKNKPYIRHEPIGYDRSRRKYWFLNRRLIIE
EDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNK
ARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQ
SLEKDSDDKTPDDDPEQGKSEEPTEVGDKGNSVSANLGDNTTNATSEETSPSEGRSPVGC
LSETPDSSNMAEKKVASELPQDVPEEPNKTCESSNTSATTTSIQPNLENSNSSSELNSSQ
SESAKAADDPENGERESHTPVSIQEEIVGDFKSEKSNGELSESPGAGKGASGSTRIITRL
RNPDSKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVIMKGNINNYF
KLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKV
LTISTLRLTITQLENNIPSSFLHPNWASHRANWIKAVQMCSKPREFALALAILECAVKPV
VMLPIWRESLGHTRLHRMTSIEREEKEKVKKKEKKQEEEETMQQATWVKYTFPVKHQVWK
QKGEEYRVTGYGGWSWISKTHVYRFVPKLPGNTNVNYRKSLEGTKNNMDENMDESDKRKC
SRSPKKIKIEPDSEKDEVKGSDAAKGADQNEMDISKITEKKDQDVKELLDSDSDKPCKEE
PMEVDDDMKTESHVNCQESSQVDVVNVSEGFHLRTSYKKKTKSSKLDGLLERRIKQFTLE
EKQRLEKIKLEGGIKGIGKTSTNSSKNLSESPVITKAKEGCQSDSMRQEQSPNANNDQPE
DLIQGCSESDSSVLRMSDPSHTTNKLYPKDRVLDDVSIRSPETKCPKQNSIENDIEEKVS
DLASRGQEPSKSKTKGNDFFIDDSKLASADDIGTLICKNKKPLIQEESDTIVSSSKSALH
SSVPKSTNDRDATPLSRAMD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R0G8	0.038	0.037	4.408E-3	1455	0.081	0.078	Q9R0G8.pdb.gz	NRK_MOUSE Nik-related protein kinase OS=Mus musculus OX=10090 GN=Nrk PE=1 SV=2
2	AFDB:O74808	0.042	0.046	1.313E-2	1238	0.081	0.092	O74808.pdb.gz	CLR1_SCHPO Cryptic loci regulator protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr1 PE=1 SV=1
3	AFDB:P32521	0.053	0.052	2.762E-2	1480	0.126	0.119	P32521.pdb.gz	PAN1_YEAST Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAN1 PE=1 SV=2
4	AFDB:O74653	0.035	0.051	3.050E-2	871	0.067	0.108	O74653.pdb.gz	POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pob1 PE=1 SV=1
5	AFDB:O77086	0.043	0.041	7.448E-2	1571	0.117	0.104	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
6	AFDB:Q5EXX3	0.036	0.040	7.827E-2	1203	0.085	0.099	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
7	AFDB:A1Z8R2	0.048	0.052	9.083E-2	1199	0.111	0.129	A1Z8R2.pdb.gz	A1Z8R2_DROME ADD domain-containing protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ADD1 PE=1 SV=1
8	AFDB:A0A0B4K7K9	0.035	0.025	1.003E-1	2238	0.070	0.044	A0A0B4K7K9.pdb.gz	A0A0B4K7K9_DROME Bruchpilot, isoform J OS=Drosophila melanogaster OX=7227 GN=brp PE=1 SV=1
9	AFDB:Q8WYB5	0.062	0.049	1.567E-1	2073	0.116	0.079	Q8WYB5.pdb.gz	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3
10	AFDB:Q8IS21	0.040	0.038	1.647E-1	1529	0.077	0.071	Q8IS21.pdb.gz	GEFB_DICDI Ras guanine nucleotide exchange factor B OS=Dictyostelium discoideum OX=44689 GN=gefB PE=2 SV=1
11	PDB:1pw4A	0.037	0.080	2.331	434	0.012	0.039	1pw4A.pdb.gz
12	PDB:7ajtUO	0.037	0.087	2.705	493	0.016	0.047	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:1copD	0.023	0.281	2.843	66	0.006	0.121	1copD.pdb.gz
14	PDB:7s5xE	0.033	0.033	3.139	1412	0.018	0.018	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
15	PDB:6yxxE6	0.040	0.090	3.466	434	0.015	0.048	6yxxE6.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
16	PDB:6ymwA	0.050	0.069	3.643	913	0.009	0.014	6ymwA.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
17	PDB:7r97A	0.056	0.186	3.643	226	0.024	0.150	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
18	PDB:7ddeA	0.026	0.057	4.023	525	0.009	0.025	7ddeA.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
19	PDB:3kq0A	0.027	0.137	4.227	175	0.010	0.080	3kq0A.pdb.gz	The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.
20	PDB:4djhB	0.046	0.109	4.668	448	0.014	0.045	4djhB.pdb.gz	tructure of the human kappa-opioid receptor in complex with JDTic

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K7N8	0.0	1818	2894	0.720	0.348	A0A0G2K7N8_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=2
2	A0A2R8Y7Q1	0.0	2631	2965	0.901	0.425	A0A2R8Y7Q1_HUMAN Bromodomain PHD finger transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=2
3	A0A8I5ZVH2	0.0	2011	3043	0.785	0.361	A0A8I5ZVH2_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
4	A0A8I6ALT2	0.0	930	2974	0.361	0.170	A0A8I6ALT2_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
5	A0A8I6GFZ0	0.0	1856	2767	0.683	0.346	A0A8I6GFZ0_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
6	A0A8I6GLB4	0.0	1879	2982	0.745	0.350	A0A8I6GLB4_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
7	A2A654	0.0	2013	3036	0.785	0.362	A2A654_MOUSE Bromodomain PHD finger transcription factor OS=Mus musculus OX=10090 GN=Bptf PE=1 SV=1
8	A2A655	0.0	1862	2973	0.744	0.350	A2A655_MOUSE Bromodomain PHD finger transcription factor OS=Mus musculus OX=10090 GN=Bptf PE=1 SV=1
9	E5D6T0	0.0	848	2640	0.284	0.151	E5D6T0_MOUSE Bromodomain PHD finger transcription factor splice variant OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
10	E7ETD6	0.0	2630	2764	0.901	0.456	E7ETD6_HUMAN Bromodomain PHD finger transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=3
11	E7F366	0.0	1145	2899	0.484	0.234	E7F366_DANRE Bromodomain PHD finger transcription factor OS=Danio rerio OX=7955 GN=bptf PE=1 SV=4
12	E9PE19	0.0	2625	2822	0.901	0.447	E9PE19_HUMAN Bromodomain PHD finger transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=4
13	E9Q6A7	0.0	927	2921	0.355	0.170	E9Q6A7_MOUSE Bromodomain PHD finger transcription factor OS=Mus musculus OX=10090 GN=Bptf PE=1 SV=1
14	F5GXF5	0.0	1111	2457	0.489	0.278	F5GXF5_HUMAN Bromodomain PHD finger transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=2
15	Q12830	0.0	2935	3046	1.000	0.460	BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=3
16	Q8CFX5	0.0	1268	826	0.476	0.808	Q8CFX5_MOUSE Bptf protein (Fragment) OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=2
17	Q9W0T1	3.14e-108	382	2669	0.139	0.073	NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster OX=7227 GN=E(bx) PE=1 SV=2
18	Q6BER5	3.03e-53	208	2194	0.083	0.053	NU301_CAEEL Nucleosome-remodeling factor subunit NURF301-like OS=Caenorhabditis elegans OX=6239 GN=nurf-1 PE=1 SV=2
19	F4K0Y2	4.00e-14	80.5	1602	0.062	0.054	F4K0Y2_ARATH PHD-finger and DNA binding domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At5g12400 PE=1 SV=1
20	F4KBB1	1.13e-11	72.4	1566	0.032	0.029	F4KBB1_ARATH PHD finger family protein OS=Arabidopsis thaliana OX=3702 GN=MDJ22.18 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06847 Arc_PepC_II	4.4e+02	12.8	Archaeal Peptidase A24 C-terminus Type II
2	PF02791 DDT	8.8e-14	62.9	DDT domain
3	PF00628 PHD	0.00011	33.3	PHD-finger
4	PF15612 WHIM1	1	20.2	WSTF, HB1, Itc1p, MBD9 motif 1
5	PF15613 WSD	0.0058	28.5	Williams-Beuren syndrome DDT (WSD), D-TOX E motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000016254

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000004849	0.987	Helicase, lymphoid-specific
2	9598.ENSPTRP00000025629	0.987	Uncharacterized protein
3	9598.ENSPTRP00000028278	0.987	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
4	9598.ENSPTRP00000046785	0.987	Chromodomain helicase DNA binding protein 1-like
5	9598.ENSPTRP00000014260	0.982	Uncharacterized protein
6	9598.ENSPTRP00000035837	0.979	DDB1 and CUL4 associated factor 10
7	9598.ENSPTRP00000012648	0.977	Uncharacterized protein
8	9598.ENSPTRP00000020279	0.977	Dpy-30 homolog
9	9598.ENSPTRP00000047486	0.977	Retinoblastoma binding protein 7
10	9598.ENSPTRP00000017884	0.974	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
11	9598.ENSPTRP00000008299	0.973	Uncharacterized protein
12	9598.ENSPTRP00000002098	0.972	Belongs to the histone H3 family.
13	9598.ENSPTRP00000016407	0.972	Belongs to the histone H3 family.
14	9598.ENSPTRP00000020176	0.972	Centromere protein A
15	9598.ENSPTRP00000021631	0.972	Histone H3
16	9598.ENSPTRP00000028251	0.972	Belongs to the histone H3 family.
17	9598.ENSPTRP00000030385	0.972	Histone H3
18	9598.ENSPTRP00000030388	0.972	Histone H3
19	9598.ENSPTRP00000030410	0.972	Histone cluster 1, H3a
20	9598.ENSPTRP00000030412	0.972	Histone H3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.995	sequence-specific DNA binding
GO:0008094	0.992	ATP-dependent activity, acting on DNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.861	multicellular organismal process
GO:0065007	0.813	biological regulation
GO:0032502	0.802	developmental process
GO:0050794	0.798	regulation of cellular process
GO:0019222	0.787	regulation of metabolic process
GO:0060255	0.749	regulation of macromolecule metabolic process
GO:0051171	0.737	regulation of nitrogen compound metabolic process
GO:0080090	0.734	regulation of primary metabolic process
GO:0031323	0.734	regulation of cellular metabolic process
GO:0010468	0.722	regulation of gene expression
GO:0051252	0.714	regulation of RNA metabolic process
GO:0050896	0.704	response to stimulus
GO:0010556	0.698	regulation of macromolecule biosynthetic process
GO:0031326	0.696	regulation of cellular biosynthetic process
GO:0048856	0.692	anatomical structure development
GO:0007275	0.673	multicellular organism development
GO:2001141	0.624	regulation of RNA biosynthetic process
GO:1903506	0.579	regulation of nucleic acid-templated transcription
GO:0006355	0.572	regulation of DNA-templated transcription
GO:0009987	0.567	cellular process
GO:0006950	0.511	response to stress
GO:0006357	0.479	regulation of transcription by RNA polymerase II
GO:0009719	0.331	response to endogenous stimulus
GO:0071840	0.312	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.906	cytoplasm
GO:0042995	0.304	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]