StarFunc result for job id Q12834

User Input

>input (499 residues)
MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12834	1.000	1.000	6.639E-92	499	1.000	1.000	Q12834.pdb.gz	CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens OX=9606 GN=CDC20 PE=1 SV=2
2	AFDB:Q6DFD4	0.649	0.639	1.682E-73	507	0.762	0.750	Q6DFD4.pdb.gz	Q6DFD4_XENLA Cell division cycle 20 L homeolog OS=Xenopus laevis OX=8355 GN=cdc20.L PE=1 SV=1
3	PDB:5lcwR	0.625	0.814	2.788E-67	383	0.768	1.000	5lcwR.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
4	AFDB:Q24044	0.629	0.598	7.584E-59	526	0.537	0.510	Q24044.pdb.gz	Q24044_DROME FI02843p OS=Drosophila melanogaster OX=7227 GN=fzy PE=2 SV=1
5	AFDB:Q54MZ3	0.629	0.629	6.889E-53	499	0.471	0.471	Q54MZ3.pdb.gz	CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum OX=44689 GN=cdc20 PE=1 SV=1
6	AFDB:Q9SZA4	0.615	0.671	4.922E-48	457	0.401	0.438	Q9SZA4.pdb.gz	CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex OS=Arabidopsis thaliana OX=3702 GN=CDC20-1 PE=1 SV=1
7	AFDB:Q5BF66	0.616	0.498	5.190E-48	618	0.377	0.304	Q5BF66.pdb.gz	Q5BF66_EMENI Cell division cycle protein Cdc20, putative (AFU_orthologue AFUA_1G14730) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00814 PE=3 SV=1
8	AFDB:P78972	0.651	0.665	1.089E-47	488	0.385	0.393	P78972.pdb.gz	SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slp1 PE=1 SV=1
9	AFDB:Q3E906	0.627	0.694	1.347E-47	450	0.381	0.422	Q3E906.pdb.gz	CD205_ARATH Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana OX=3702 GN=CDC20-5 PE=1 SV=3
10	AFDB:Q8VZS9	0.617	0.648	5.062E-47	475	0.369	0.387	Q8VZS9.pdb.gz	FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=FZR1 PE=1 SV=1
11	AFDB:Q8L3Z8	0.615	0.635	5.628E-47	483	0.373	0.385	Q8L3Z8.pdb.gz	FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana OX=3702 GN=FZR2 PE=1 SV=1
12	PDB:4ui9R	0.592	0.760	1.430E-38	387	0.331	0.426	4ui9R.pdb.gz	Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
13	PDB:7qe7R	0.605	0.685	9.624E-38	440	0.359	0.407	7qe7R.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:5nnzA	0.501	0.721	1.819E-20	335	0.130	0.194	5nnzA.pdb.gz
15	PDB:5mzhB	0.486	0.578	5.835E-20	415	0.120	0.145	5mzhB.pdb.gz
16	PDB:5jcsq	0.459	0.468	1.596E-19	488	0.150	0.154	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
17	PDB:7bt6x	0.474	0.484	2.571E-19	488	0.158	0.162	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
18	PDB:2h9lA	0.533	0.810	3.726E-19	321	0.160	0.249	2h9lA.pdb.gz
19	PDB:5yzgs	0.498	0.653	4.605E-19	374	0.092	0.123	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:7qdrC	0.516	0.816	7.035E-19	305	0.114	0.187	7qdrC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12834	0.0	1028	499	1.000	1.000	CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens OX=9606 GN=CDC20 PE=1 SV=2
2	Q5H7C0	0.0	1016	499	0.982	0.982	CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa OX=9823 GN=CDC20 PE=2 SV=1
3	Q62623	0.0	984	499	0.950	0.950	CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus OX=10116 GN=Cdc20 PE=1 SV=2
4	Q6DFD4	0.0	813	507	0.762	0.750	Q6DFD4_XENLA Cell division cycle 20 L homeolog OS=Xenopus laevis OX=8355 GN=cdc20.L PE=1 SV=1
5	Q8AVG7	0.0	817	506	0.764	0.753	Q8AVG7_XENLA Cdc20 protein OS=Xenopus laevis OX=8355 GN=cdc20.S PE=1 SV=1
6	Q9JJ66	0.0	984	499	0.948	0.948	CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus OX=10090 GN=Cdc20 PE=1 SV=2
7	Q24044	2.33e-178	513	526	0.539	0.511	Q24044_DROME FI02843p OS=Drosophila melanogaster OX=7227 GN=fzy PE=2 SV=1
8	Q6NR32	5.22e-178	512	526	0.539	0.511	Q6NR32_DROME RE39287p OS=Drosophila melanogaster OX=7227 GN=fzy PE=2 SV=1
9	Q54MZ3	2.06e-149	438	499	0.481	0.481	CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum OX=44689 GN=cdc20 PE=1 SV=1
10	Q9SZA4	7.06e-129	384	457	0.399	0.435	CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex OS=Arabidopsis thaliana OX=3702 GN=CDC20-1 PE=1 SV=1
11	Q9S7I8	4.10e-128	382	447	0.395	0.441	CDC22_ARATH Cell division cycle 20.2, cofactor of APC complex OS=Arabidopsis thaliana OX=3702 GN=CDC20-2 PE=1 SV=1
12	Q3E906	3.83e-120	362	450	0.385	0.427	CD205_ARATH Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana OX=3702 GN=CDC20-5 PE=1 SV=3
13	Q9S7H3	1.48e-117	355	442	0.377	0.425	CD203_ARATH Cell division cycle 20.3, cofactor of APC complex OS=Arabidopsis thaliana OX=3702 GN=CDC20-3 PE=3 SV=1
14	Q5B915	2.47e-115	354	592	0.325	0.274	Q5B915_EMENI Cell cycle regulatory protein (Srw1), putative (AFU_orthologue AFUA_3G08280) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02965 PE=4 SV=1
15	P78972	1.45e-114	348	488	0.371	0.379	SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slp1 PE=1 SV=1
16	Q8L3Z8	3.09e-108	332	483	0.361	0.373	FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana OX=3702 GN=FZR2 PE=1 SV=1
17	Q8LPL5	4.08e-107	329	481	0.307	0.318	FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana OX=3702 GN=FZR3 PE=1 SV=1
18	O18402	6.97e-107	328	478	0.319	0.333	O18402_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=fzr PE=2 SV=1
19	Q9W4H9	7.04e-107	328	478	0.319	0.333	Q9W4H9_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=fzr PE=2 SV=1
20	Q8VZS9	1.09e-105	325	475	0.365	0.383	FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=FZR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.9e-16	71.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08662 eIF2A	0.00016	33.2	Eukaryotic translation initiation factor eIF2A
3	PF16687 ELYS-bb	1.5e+02	12.4	beta-propeller of ELYS nucleoporin
4	PF16529 Ge1_WD40	0.35	21.4	WD40 region of Ge1, enhancer of mRNA-decapping protein
5	PF20426 NBCH_WD40	7.3e-06	36.6	Neurobeachin beta propeller domain
6	PF18764 nos_propeller	2.8e+02	12.8	Nitrous oxide reductase propeller repeat
7	PF00400 WD40	2e-23	93.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361540

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216911	0.999	Aurora kinase A
2	9606.ENSP00000229758	0.999	F-box only protein 5
3	9606.ENSP00000256442	0.999	G2/mitotic-specific cyclin-B1
4	9606.ENSP00000274026	0.999	Cyclin-A2
5	9606.ENSP00000287598	0.999	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
6	9606.ENSP00000288207	0.999	G2/mitotic-specific cyclin-B2
7	9606.ENSP00000296509	0.999	Mitotic spindle assembly checkpoint protein MAD2A
8	9606.ENSP00000300093	0.999	Serine/threonine-protein kinase PLK1
9	9606.ENSP00000302530	0.999	Mitotic checkpoint serine/threonine-protein kinase BUB1
10	9606.ENSP00000314004	0.999	Anaphase-promoting complex subunit 2
11	9606.ENSP00000339109	0.999	Anaphase-promoting complex subunit 1
12	9606.ENSP00000348838	0.999	Ubiquitin-conjugating enzyme E2 C
13	9606.ENSP00000353549	0.999	Cell division cycle protein 16 homolog
14	9606.ENSP00000355966	0.999	Serine/threonine-protein kinase Nek2
15	9606.ENSP00000357858	0.999	Mitotic checkpoint protein BUB3
16	9606.ENSP00000377536	0.999	Securin
17	9606.ENSP00000378350	0.999	Cell division cycle protein 23 homolog
18	9606.ENSP00000378699	0.999	Cyclin-dependent kinase 1
19	9606.ENSP00000394394	0.999	Anaphase-promoting complex subunit 7
20	9606.ENSP00000434614	0.999	Cell division cycle protein 27 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0019899	0.981	enzyme binding
GO:0003676	0.341	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.997	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0008152	0.989	metabolic process
GO:0044238	0.983	primary metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0044237	0.974	cellular metabolic process
GO:0048522	0.967	positive regulation of cellular process
GO:0031145	0.945	anaphase-promoting complex-dependent catabolic process
GO:0051726	0.939	regulation of cell cycle
GO:0019222	0.911	regulation of metabolic process
GO:0060255	0.877	regulation of macromolecule metabolic process
GO:0010564	0.850	regulation of cell cycle process
GO:2000241	0.842	regulation of reproductive process
GO:0090068	0.842	positive regulation of cell cycle process
GO:0051171	0.752	regulation of nitrogen compound metabolic process
GO:0051445	0.738	regulation of meiotic cell cycle
GO:0051128	0.714	regulation of cellular component organization
GO:0080090	0.677	regulation of primary metabolic process
GO:0048519	0.608	negative regulation of biological process
GO:0071840	0.604	cellular component organization or biogenesis
GO:0009893	0.575	positive regulation of metabolic process
GO:0016043	0.559	cellular component organization
GO:0000278	0.548	mitotic cell cycle
GO:0022402	0.539	cell cycle process
GO:0010604	0.539	positive regulation of macromolecule metabolic process
GO:0051173	0.530	positive regulation of nitrogen compound metabolic process
GO:0051246	0.461	regulation of protein metabolic process
GO:0006996	0.453	organelle organization
GO:0031323	0.434	regulation of cellular metabolic process
GO:0065009	0.426	regulation of molecular function
GO:1903047	0.380	mitotic cell cycle process
GO:0048523	0.360	negative regulation of cellular process
GO:0050790	0.309	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0005856	0.996	cytoskeleton
GO:0005654	0.996	nucleoplasm
GO:0015630	0.980	microtubule cytoskeleton
GO:0005829	0.975	cytosol
GO:0140513	0.928	nuclear protein-containing complex
GO:1902494	0.747	catalytic complex
GO:0140535	0.609	intracellular protein-containing complex
GO:1990234	0.604	transferase complex
GO:0005815	0.506	microtubule organizing center
GO:0000151	0.479	ubiquitin ligase complex
GO:0031461	0.396	cullin-RING ubiquitin ligase complex
GO:0005819	0.370	spindle
GO:0005813	0.353	centrosome
GO:0005680	0.336	anaphase-promoting complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]