StarFunc result for job id Q12837

User Input

>input (409 residues)
MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSSSNAGGGGGGG
GGGGGGGGRSSSSSSSGSSGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIV
SQSKSHHHHPPHHSPFKPDATYHTMNTIPCTSAASSSSVPISHPSALAGTHHHHHHHHHH
HHQPHQALEGELLEHLSPGLALGAMAGPDGAVVSTPAHAPHMATMNPMHQAALSMAHAHG
LPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTIC
RFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKRTSIAAPEKRSL
EAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V7L5	0.445	0.442	4.248E-47	412	0.988	0.981	G3V7L5.pdb.gz	PO4F2_RAT POU domain, class 4, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou4f2 PE=1 SV=1
2	AFDB:Q6XZH1	0.439	0.465	2.917E-39	384	0.834	0.888	Q6XZH1.pdb.gz	Q6XZH1_DANRE POU domain protein OS=Danio rerio OX=7955 GN=brn-3b PE=2 SV=1
3	AFDB:F1Q813	0.370	0.409	2.069E-25	368	0.611	0.679	F1Q813.pdb.gz
4	AFDB:P24350	0.216	0.223	3.969E-21	396	0.450	0.465	P24350.pdb.gz	IPOU_DROME Inhibitory POU protein OS=Drosophila melanogaster OX=7227 GN=acj6 PE=1 SV=3
5	AFDB:P13528	0.222	0.195	6.172E-17	467	0.396	0.347	P13528.pdb.gz	UNC86_CAEEL Transcription factor unc-86 OS=Caenorhabditis elegans OX=6239 GN=unc-86 PE=1 SV=2
6	AFDB:P79746	0.213	0.225	6.611E-14	378	0.291	0.315	P79746.pdb.gz	PO3F2_DANRE POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1
7	AFDB:A7Y7W2	0.223	0.233	1.700E-13	389	0.264	0.278	A7Y7W2.pdb.gz	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
8	AFDB:P31367	0.221	0.165	1.268E-9	610	0.249	0.167	P31367.pdb.gz	PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio OX=7955 GN=pou6f1 PE=2 SV=1
9	AFDB:A0A1C7CYY7	0.244	0.184	2.380E-9	577	0.235	0.166	A0A1C7CYY7.pdb.gz	A0A1C7CYY7_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
10	AFDB:A0A0B4JD55	0.256	0.098	2.816E-7	1292	0.230	0.073	A0A0B4JD55.pdb.gz	A0A0B4JD55_DROME Pou domain motif 3, isoform F OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=4 SV=1
11	PDB:6t90K	0.167	0.883	3.552E-5	73	0.095	0.534	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
12	PDB:4egcA	0.140	0.116	7.887E-3	539	0.081	0.061	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:1b0nA	0.104	0.349	1.145E-1	103	0.039	0.155	1b0nA.pdb.gz	An evolutionary link between sporulation and prophage induction in the structure of a repressor:anti-repressor complex.
14	PDB:5iplF	0.083	0.105	2.039E-1	277	0.059	0.087	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
15	PDB:3dnvB	0.125	0.622	4.032E-1	71	0.042	0.239	3dnvB.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
16	PDB:3f51A	0.117	0.434	4.478E-1	94	0.037	0.160	3f51A.pdb.gz
17	PDB:7f0rF	0.082	0.113	5.241E-1	278	0.051	0.076	7f0rF.pdb.gz	Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
18	PDB:6cf1B	0.110	0.409	6.812E-1	94	0.029	0.128	6cf1B.pdb.gz
19	PDB:6dv9F	0.081	0.156	8.855E-1	174	0.049	0.115	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
20	PDB:1zp2A	0.089	0.136	1.151	227	0.049	0.088	1zp2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V7L5	0.0	806	412	0.988	0.981	PO4F2_RAT POU domain, class 4, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou4f2 PE=1 SV=1
2	Q12837	0.0	824	409	1.000	1.000	PO4F2_HUMAN POU domain, class 4, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU4F2 PE=1 SV=2
3	Q63934	0.0	804	411	0.985	0.981	PO4F2_MOUSE POU domain, class 4, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou4f2 PE=1 SV=1
4	Q6XZH1	0.0	544	384	0.800	0.852	Q6XZH1_DANRE POU domain protein OS=Danio rerio OX=7955 GN=brn-3b PE=2 SV=1
5	Q15319	9.64e-154	439	338	0.579	0.701	PO4F3_HUMAN POU domain, class 4, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU4F3 PE=1 SV=1
6	Q63955	5.30e-153	437	338	0.577	0.698	PO4F3_MOUSE POU domain, class 4, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou4f3 PE=1 SV=2
7	Q90435	1.80e-136	395	331	0.570	0.704	PO4F3_DANRE POU domain, class 4, transcription factor 3 OS=Danio rerio OX=7955 GN=pou4f3 PE=2 SV=2
8	Q7SZN6	2.89e-126	370	366	0.555	0.620	Q7SZN6_DANRE POU domain protein OS=Danio rerio OX=7955 GN=brn3a PE=2 SV=1
9	P24350	1.13e-94	291	396	0.430	0.444	IPOU_DROME Inhibitory POU protein OS=Drosophila melanogaster OX=7227 GN=acj6 PE=1 SV=3
10	P13528	9.12e-79	249	357	0.291	0.333	UNC86_CAEEL Transcription factor unc-86 OS=Caenorhabditis elegans OX=6239 GN=unc-86 PE=1 SV=2
11	P16241	1.12e-46	167	427	0.196	0.187	CF1A_DROME POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5
12	Q2VUE0	1.49e-44	157	260	0.193	0.304	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
13	P56222	2.28e-44	161	445	0.191	0.175	PO3F2_RAT POU domain, class 3, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou3f2 PE=1 SV=1
14	P20265	3.50e-44	161	443	0.191	0.176	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4
15	P20264	1.93e-43	160	500	0.191	0.156	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
16	P31361	1.96e-43	160	497	0.191	0.157	PO3F3_MOUSE POU domain, class 3, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou3f3 PE=2 SV=2
17	Q63262	2.00e-43	160	497	0.191	0.157	PO3F3_RAT POU domain, class 3, transcription factor 3 OS=Rattus norvegicus OX=10116 GN=Pou3f3 PE=1 SV=2
18	P79746	2.64e-43	157	378	0.186	0.201	PO3F2_DANRE POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1
19	P20267	5.50e-43	158	451	0.203	0.184	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
20	P62515	5.88e-43	155	361	0.186	0.211	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15994 DUF4770	7.5e+02	11.8	Domain of unknown function (DUF4770)
2	PF05920 Homeobox_KN	6.1e+02	11.8	Homeobox KN domain
3	PF00046 Homeodomain	7.9e-14	62.6	Homeodomain
4	PF13560 HTH_31	8.2	18.2	Helix-turn-helix domain
5	PF00157 Pou	2.1e-28	109.4	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281321

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.986	Estrogen receptor
2	9606.ENSP00000362777	0.851	Protein atonal homolog 7
3	9606.ENSP00000261980	0.813	Visual system homeobox 2
4	9606.ENSP00000230658	0.802	Insulin gene enhancer protein ISL-1
5	9606.ENSP00000340176	0.781	RNA-binding protein with multiple splicing
6	9606.ENSP00000361141	0.781	Melanopsin
7	9606.ENSP00000404100	0.715	Paired box protein Pax-6
8	9606.ENSP00000269305	0.664	Cellular tumor antigen p53
9	9606.ENSP00000296786	0.660	Ubiquitin-like domain-containing CTD phosphatase 1
10	9606.ENSP00000321805	0.643	GTP-binding protein Rit2
11	9606.ENSP00000221996	0.640	Cone-rod homeobox protein
12	9606.ENSP00000226193	0.637	Recoverin
13	9606.ENSP00000359474	0.623	BarH-like 2 homeobox protein
14	9606.ENSP00000299162	0.622	Forkhead box protein N4
15	9606.ENSP00000324857	0.619	Semaphorin-6D
16	9606.ENSP00000361087	0.610	Gamma-synuclein
17	9606.ENSP00000351141	0.606	Pre-mRNA-splicing regulator WTAP
18	9606.ENSP00000365899	0.601	Visual system homeobox 1
19	9606.ENSP00000290759	0.598	Insulin gene enhancer protein ISL-2
20	9606.ENSP00000260653	0.597	Homeobox protein SIX3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0000976	0.988	transcription cis-regulatory region binding
GO:0000977	0.732	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.305	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.977	cellular process
GO:0009889	0.970	regulation of biosynthetic process
GO:0032501	0.967	multicellular organismal process
GO:0048518	0.957	positive regulation of biological process
GO:0006355	0.945	regulation of DNA-templated transcription
GO:0048522	0.918	positive regulation of cellular process
GO:0050896	0.915	response to stimulus
GO:0032502	0.908	developmental process
GO:0010604	0.907	positive regulation of macromolecule metabolic process
GO:0031325	0.905	positive regulation of cellular metabolic process
GO:0051173	0.904	positive regulation of nitrogen compound metabolic process
GO:0009891	0.838	positive regulation of biosynthetic process
GO:0007154	0.797	cell communication
GO:0048523	0.775	negative regulation of cellular process
GO:0045935	0.756	positive regulation of nucleobase-containing compound metabolic process
GO:0048856	0.750	anatomical structure development
GO:0007275	0.744	multicellular organism development
GO:0051716	0.739	cellular response to stimulus
GO:0048731	0.698	system development
GO:0010557	0.689	positive regulation of macromolecule biosynthetic process
GO:0031328	0.688	positive regulation of cellular biosynthetic process
GO:0042221	0.607	response to chemical
GO:0051254	0.565	positive regulation of RNA metabolic process
GO:0045893	0.527	positive regulation of DNA-templated transcription
GO:0006357	0.526	regulation of transcription by RNA polymerase II
GO:0048513	0.482	animal organ development
GO:0045944	0.331	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.980	nuclear lumen
GO:0005654	0.948	nucleoplasm
GO:0005737	0.480	cytoplasm
GO:0043232	0.400	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]