StarFunc result for job id Q12840

User Input

>input (1032 residues)
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
ATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQETAAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IWI7	0.363	0.363	0.000	1033	0.721	0.720	A0A0R4IWI7.pdb.gz	A0A0R4IWI7_DANRE Kinesin family member 5A OS=Danio rerio OX=7955 GN=kif5a PE=3 SV=1
2	AFDB:F1R5M2	0.596	0.629	0.000	968	0.659	0.702	F1R5M2.pdb.gz	F1R5M2_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=kif5ba PE=1 SV=1
3	AFDB:O60282	0.381	0.409	0.000	957	0.697	0.751	O60282.pdb.gz	KIF5C_HUMAN Kinesin heavy chain isoform 5C OS=Homo sapiens OX=9606 GN=KIF5C PE=1 SV=1
4	AFDB:Q12840	1.000	1.000	0.000	1032	1.000	1.000	Q12840.pdb.gz	KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sapiens OX=9606 GN=KIF5A PE=1 SV=2
5	AFDB:P33176	0.376	0.402	4.438E-103	963	0.658	0.705	P33176.pdb.gz	KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1
6	AFDB:A0A286YA13	0.462	0.510	6.312E-90	924	0.632	0.706	A0A286YA13.pdb.gz
7	AFDB:P17210	0.426	0.448	9.029E-89	975	0.547	0.578	P17210.pdb.gz	KINH_DROME Kinesin heavy chain OS=Drosophila melanogaster OX=7227 GN=Khc PE=1 SV=2
8	AFDB:P34540	0.379	0.478	2.259E-72	815	0.412	0.521	P34540.pdb.gz	KINH_CAEEL Kinesin heavy chain OS=Caenorhabditis elegans OX=6239 GN=unc-116 PE=2 SV=2
9	AFDB:P48467	0.386	0.427	6.696E-56	928	0.314	0.349	P48467.pdb.gz	KINH_NEUCR Kinesin heavy chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=kin PE=1 SV=2
10	AFDB:Q9US60	0.329	0.607	4.835E-46	554	0.197	0.366	Q9US60.pdb.gz	KLP3_SCHPO Kinesin-like protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp3 PE=2 SV=1
11	PDB:7wrgA	0.298	0.377	3.664E-31	812	0.134	0.170	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.295	0.386	6.099E-31	783	0.126	0.166	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.260	0.396	8.712E-27	670	0.104	0.160	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:7w85A	0.072	0.140	4.706E-2	435	0.039	0.092	7w85A.pdb.gz
15	PDB:5w3sA	0.050	0.090	9.283E-2	485	0.031	0.066	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.
16	PDB:1m2vA	0.056	0.075	1.380E-1	705	0.034	0.050	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
17	PDB:5fm7B	0.044	0.079	1.545E-1	422	0.026	0.064	5fm7B.pdb.gz	The Combination of X-Ray Crystallography and Cryo-Electron Microscopy Provides Insight Into the Overall Architecture of the Dodecameric Rvb1/Rvb2 Complex.
18	PDB:3sqbE	0.042	0.152	1.730E-1	176	0.016	0.091	3sqbE.pdb.gz
19	PDB:6d7gA	0.052	0.109	1.938E-1	386	0.016	0.041	6d7gA.pdb.gz
20	PDB:7dysA	0.060	0.123	2.170E-1	387	0.027	0.072	7dysA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IRM1	0.0	1342	959	0.662	0.712	A0A0R4IRM1_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=kif5bb PE=1 SV=1
2	A0A0R4IWI7	0.0	1469	1033	0.734	0.733	A0A0R4IWI7_DANRE Kinesin family member 5A OS=Danio rerio OX=7955 GN=kif5a PE=3 SV=1
3	F1R5M2	0.0	1379	968	0.659	0.702	F1R5M2_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=kif5ba PE=1 SV=1
4	O60282	0.0	1420	957	0.694	0.748	KIF5C_HUMAN Kinesin heavy chain isoform 5C OS=Homo sapiens OX=9606 GN=KIF5C PE=1 SV=1
5	P17210	0.0	1107	975	0.545	0.576	KINH_DROME Kinesin heavy chain OS=Drosophila melanogaster OX=7227 GN=Khc PE=1 SV=2
6	P28738	0.0	1416	956	0.691	0.746	KIF5C_MOUSE Kinesin heavy chain isoform 5C OS=Mus musculus OX=10090 GN=Kif5c PE=1 SV=3
7	P33175	0.0	2076	1027	0.977	0.981	KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus musculus OX=10090 GN=Kif5a PE=1 SV=3
8	P33176	0.0	1355	963	0.656	0.703	KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1
9	P34540	0.0	620	815	0.314	0.398	KINH_CAEEL Kinesin heavy chain OS=Caenorhabditis elegans OX=6239 GN=unc-116 PE=2 SV=2
10	P56536	0.0	1415	955	0.692	0.748	KIF5C_RAT Kinesin heavy chain isoform 5C OS=Rattus norvegicus OX=10116 GN=Kif5c PE=1 SV=3
11	Q12840	0.0	2128	1032	1.000	1.000	KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sapiens OX=9606 GN=KIF5A PE=1 SV=2
12	Q2PQA9	0.0	1351	963	0.658	0.705	KINH_RAT Kinesin-1 heavy chain OS=Rattus norvegicus OX=10116 GN=Kif5b PE=1 SV=1
13	Q504B9	0.0	670	349	0.300	0.888	Q504B9_DANRE Kinesin-like protein (Fragment) OS=Danio rerio OX=7955 GN=LOC553428 PE=2 SV=1
14	Q61768	0.0	1348	963	0.657	0.704	KINH_MOUSE Kinesin-1 heavy chain OS=Mus musculus OX=10090 GN=Kif5b PE=1 SV=3
15	Q6QLM7	0.0	2055	1027	0.968	0.973	KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus norvegicus OX=10116 GN=Kif5a PE=1 SV=1
16	V9HW29	0.0	1355	963	0.656	0.703	V9HW29_HUMAN Kinesin-like protein OS=Homo sapiens OX=9606 GN=HEL-S-61 PE=1 SV=1
17	P48467	1.24e-127	412	928	0.216	0.240	KINH_NEUCR Kinesin heavy chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=kin PE=1 SV=2
18	Q54UC9	2.97e-119	396	1193	0.190	0.164	KIF3_DICDI Kinesin-related protein 3 OS=Dictyostelium discoideum OX=44689 GN=kif3 PE=1 SV=1
19	O70402	9.16e-107	331	163	0.156	0.988	O70402_MOUSE Kinesin heavy chain (Fragment) OS=Mus musculus OX=10090 PE=2 SV=1
20	Q5A3K5	1.47e-105	353	904	0.175	0.200	Q5A3K5_CANAL Kip4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KIP4 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	1.9e+02	13.7	Autophagy protein 16 (ATG16)
2	PF00225 Kinesin	1.4e-107	371.1	Kinesin motor domain
3	PF16796 Microtub_bd	2.8e-20	84.3	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010387254.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010351887.1	0.989	Kinesin light chain 1
2	61622.XP_010368006.1	0.985	Kinesin light chain 4
3	61622.XP_010364730.1	0.980	Kinesin light chain 2
4	61622.XP_010356352.1	0.977	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
5	61622.XP_010355332.1	0.969	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
6	61622.XP_010375788.1	0.967	Kinesin light chain 3
7	61622.XP_010356347.1	0.940	Glutamate ionotropic receptor AMPA type subunit 2
8	61622.XP_010377534.1	0.881	Dynactin subunit 1 isoform X1
9	61622.XP_010376458.1	0.866	Belongs to the intermediate filament family.
10	61622.XP_010384888.1	0.865	Huntingtin associated protein 1
11	61622.XP_010353247.1	0.864	Trafficking kinesin-binding protein 2
12	61622.XP_010376457.1	0.864	Belongs to the intermediate filament family.
13	61622.XP_010376613.1	0.853	Glutamate receptor 1
14	61622.XP_010357673.1	0.850	Belongs to the intermediate filament family.
15	61622.XP_010361101.1	0.850	Glutamate ionotropic receptor AMPA type subunit 4
16	61622.XP_010385394.1	0.845	Belongs to the protein kinase superfamily.
17	61622.XP_010356996.1	0.844	Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family
18	61622.XP_010374577.1	0.833	Belongs to the synuclein family.
19	61622.XP_010372609.1	0.829	Trafficking kinesin protein 1
20	61622.XP_010383710.1	0.791	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	1.000	ATP-dependent activity
GO:0003774	1.000	cytoskeletal motor activity
GO:0005515	1.000	protein binding
GO:0003777	0.963	microtubule motor activity
GO:0008092	0.757	cytoskeletal protein binding
GO:0015631	0.451	tubulin binding
GO:0008017	0.443	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0006810	0.985	transport
GO:0051641	0.979	cellular localization
GO:0030705	0.959	cytoskeleton-dependent intracellular transport
GO:0007017	0.903	microtubule-based process
GO:0099111	0.877	microtubule-based transport
GO:0065007	0.821	biological regulation
GO:0007018	0.697	microtubule-based movement
GO:0050789	0.695	regulation of biological process
GO:0050794	0.685	regulation of cellular process
GO:0010970	0.672	transport along microtubule
GO:0071840	0.515	cellular component organization or biogenesis
GO:0016043	0.488	cellular component organization
GO:0008088	0.394	axo-dendritic transport
GO:0050896	0.386	response to stimulus
GO:0032501	0.376	multicellular organismal process
GO:0048856	0.332	anatomical structure development
GO:0007154	0.332	cell communication
GO:0023052	0.310	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005737	0.999	cytoplasm
GO:0015630	0.998	microtubule cytoskeleton
GO:0043227	0.993	membrane-bounded organelle
GO:0005829	0.988	cytosol
GO:0016020	0.987	membrane
GO:0005875	0.975	microtubule associated complex
GO:0005871	0.965	kinesin complex
GO:0043231	0.901	intracellular membrane-bounded organelle
GO:0043005	0.580	neuron projection
GO:0031982	0.549	vesicle
GO:0005815	0.355	microtubule organizing center
GO:0005929	0.347	cilium
GO:0099513	0.324	polymeric cytoskeletal fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]