StarFunc result for job id Q12851

User Input

>input (820 residues)
MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQ
EITILRECRHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAYVCREA
LKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAP
EVAAVERKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKT
RWTQNFHHFLKLALTKNPKKRPTAEKLLQHPFTTQQLPRALLTQLLDKASDPHLGTPSPE
DCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNEPWEEEWTLLG
KEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEP
LSSPPGTLPPPPSGPNSSPLLPTAWATMKQREDPERSSCHGLPPTPKVHMGACFSKVFNG
CPLRIHAAVTWIHPVTRDQFLVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVL
LSLSGKSTHIWAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPRRFALSTKIPDTKGCLQ
CRVVRNPYTGATFLLAALPTSLLLLQWYEPLQKFLLLKNFSSPLPSPAGMLEPLVLDGKE
LPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEGIPGSAQQVIQVDRDTILVSFE
RCVRIVNMQGEPTATLAPELTFDFPIETVVCLQDSVLAFWSHGMQGRSLDTNEVTQEITD
ETRIFRVLGAHRDIILESIPTDNPEAHSNLYILTGHQSTY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61161	0.926	0.925	0.000	821	0.938	0.937	Q61161.pdb.gz	M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus OX=10090 GN=Map4k2 PE=1 SV=1
2	AFDB:Q924I2	0.628	0.594	1.476E-100	873	0.562	0.528	Q924I2.pdb.gz	M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus OX=10116 GN=Map4k3 PE=1 SV=2
3	AFDB:Q8IVH8	0.591	0.548	1.042E-96	894	0.565	0.518	Q8IVH8.pdb.gz	M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP4K3 PE=1 SV=1
4	AFDB:Q9Y4K4	0.583	0.569	2.376E-96	846	0.538	0.521	Q9Y4K4.pdb.gz	M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP4K5 PE=1 SV=2
5	AFDB:A1ZBH8	0.650	0.573	1.936E-83	947	0.473	0.410	A1ZBH8.pdb.gz	A1ZBH8_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
6	AFDB:A0A0B4LGY8	0.664	0.572	3.078E-83	968	0.479	0.406	A0A0B4LGY8.pdb.gz	A0A0B4LGY8_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
7	AFDB:A1ZBH7	0.700	0.487	4.955E-79	1218	0.484	0.326	A1ZBH7.pdb.gz	A1ZBH7_DROME Happyhour, isoform A OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
8	AFDB:P70218	0.526	0.522	6.750E-79	827	0.435	0.432	P70218.pdb.gz	M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus OX=10090 GN=Map4k1 PE=1 SV=1
9	AFDB:Q92918	0.510	0.504	1.797E-78	833	0.430	0.424	Q92918.pdb.gz	M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP4K1 PE=1 SV=1
10	AFDB:M9PBJ7	0.424	0.308	5.093E-45	1213	0.302	0.204	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
11	PDB:4eomC	0.296	0.834	3.156E-20	276	0.091	0.272	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
12	PDB:5u6yA	0.291	0.505	5.563E-20	459	0.109	0.194	5u6yA.pdb.gz
13	PDB:3eqdA	0.298	0.733	4.149E-19	315	0.101	0.263	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
14	PDB:1unlA	0.291	0.778	7.700E-19	292	0.099	0.277	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
15	PDB:4yc3A	0.288	0.756	4.216E-18	295	0.090	0.251	4yc3A.pdb.gz
16	PDB:4krcA	0.298	0.791	7.058E-18	297	0.094	0.259	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:6byrA	0.285	0.558	1.310E-17	405	0.087	0.175	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
18	PDB:3c4wB	0.288	0.445	2.987E-17	519	0.083	0.131	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
19	PDB:4rewA	0.294	0.566	2.987E-17	411	0.098	0.195	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:5x3fB	0.282	0.628	3.311E-17	349	0.084	0.198	5x3fB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12851	0.0	1682	820	1.000	1.000	M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP4K2 PE=1 SV=2
2	Q61161	0.0	1551	821	0.939	0.938	M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus OX=10090 GN=Map4k2 PE=1 SV=1
3	Q8IVH8	0.0	910	894	0.568	0.521	M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP4K3 PE=1 SV=1
4	Q924I2	0.0	904	873	0.568	0.534	M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus OX=10116 GN=Map4k3 PE=1 SV=2
5	Q99JP0	0.0	903	894	0.572	0.525	M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map4k3 PE=1 SV=4
6	Q9Y4K4	0.0	879	846	0.541	0.525	M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP4K5 PE=1 SV=2
7	A0A0B4LFQ3	2.39e-136	429	934	0.239	0.210	A0A0B4LFQ3_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
8	A1ZBH8	2.86e-136	430	947	0.239	0.207	A1ZBH8_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
9	Q8SYA1	2.86e-136	430	947	0.239	0.207	Q8SYA1_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=hppy PE=2 SV=1
10	A0A0B4LGY8	4.59e-136	430	968	0.239	0.202	A0A0B4LGY8_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
11	A1ZBH7	1.72e-134	432	1218	0.265	0.178	A1ZBH7_DROME Happyhour, isoform A OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
12	A0A0B4LFV0	3.54e-134	431	1205	0.239	0.163	A0A0B4LFV0_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
13	P70218	2.25e-126	400	827	0.224	0.222	M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus OX=10090 GN=Map4k1 PE=1 SV=1
14	Q92918	1.07e-122	391	833	0.229	0.226	M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP4K1 PE=1 SV=1
15	O24527	1.71e-85	291	836	0.171	0.167	SIK1_ARATH Serine/threonine-protein kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SIK1 PE=1 SV=1
16	O00506	5.30e-80	266	426	0.179	0.345	STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens OX=9606 GN=STK25 PE=1 SV=1
17	Q96BA2	6.32e-80	265	426	0.179	0.345	Q96BA2_HUMAN STK25 protein OS=Homo sapiens OX=9606 PE=1 SV=1
18	O61125	1.09e-79	266	461	0.151	0.269	STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum OX=44689 GN=krsA PE=1 SV=1
19	Q6V9V9	3.19e-79	263	426	0.178	0.343	Q6V9V9_RAT Serine/threonine kinase 25 OS=Rattus norvegicus OX=10116 GN=Stk25 PE=1 SV=1
20	Q9Z2W1	3.19e-79	263	426	0.178	0.343	STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus OX=10090 GN=Stk25 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	6.2	17.4	ABC1 atypical kinase-like domain
2	PF00780 CNH	1.4e-48	177.6	CNH domain
3	PF14531 Kinase-like	1.8e+02	12.9	Kinase-like
4	PF00069 Pkinase	1.1e-57	207.0	Protein kinase domain
5	PF17667 Pkinase_fungal	4.9	17.4	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	4.9e-36	135.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294066

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382423	0.957	Mitogen-activated protein kinase kinase kinase 1
2	9606.ENSP00000247668	0.938	TNF receptor-associated factor 2
3	9606.ENSP00000341268	0.938	Tumor necrosis factor receptor type 1-associated DEATH domain protein
4	9606.ENSP00000376505	0.932	TRAF family member-associated NF-kappa-B activator
5	9606.ENSP00000383118	0.928	Cell division control protein 42 homolog
6	9606.ENSP00000162749	0.914	Tumor necrosis factor receptor superfamily member 1A
7	9606.ENSP00000398698	0.909	Tumor necrosis factor
8	9606.ENSP00000312664	0.905	Caspase-2
9	9606.ENSP00000259808	0.902	Receptor-interacting serine/threonine-protein kinase 1
10	9606.ENSP00000348461	0.902	Ras-related C3 botulinum toxin substrate 1
11	9606.ENSP00000439068	0.900	Death domain-containing protein CRADD
12	9606.ENSP00000300935	0.874	Ras-related protein Rab-8A
13	9606.ENSP00000329933	0.727	PHD finger protein 12
14	9606.ENSP00000376506	0.665	Programmed cell death protein 10
15	9606.ENSP00000358810	0.553	Striatin-interacting protein 1
16	9606.ENSP00000367050	0.515	Reticulon-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	1.000	ATP binding
GO:0019899	0.879	enzyme binding
GO:0019900	0.844	kinase binding
GO:0019901	0.784	protein kinase binding
GO:0031435	0.685	mitogen-activated protein kinase kinase kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0007165	0.982	signal transduction
GO:0048518	0.969	positive regulation of biological process
GO:0019222	0.965	regulation of metabolic process
GO:0071704	0.957	organic substance metabolic process
GO:0043170	0.950	macromolecule metabolic process
GO:0000165	0.933	MAPK cascade
GO:0080090	0.926	regulation of primary metabolic process
GO:0060255	0.926	regulation of macromolecule metabolic process
GO:0044238	0.923	primary metabolic process
GO:0051171	0.923	regulation of nitrogen compound metabolic process
GO:0031323	0.916	regulation of cellular metabolic process
GO:0006807	0.912	nitrogen compound metabolic process
GO:0031098	0.896	stress-activated protein kinase signaling cascade
GO:0048522	0.895	positive regulation of cellular process
GO:0043408	0.889	regulation of MAPK cascade
GO:0001932	0.885	regulation of protein phosphorylation
GO:0071900	0.875	regulation of protein serine/threonine kinase activity
GO:1902533	0.870	positive regulation of intracellular signal transduction
GO:0043405	0.861	regulation of MAP kinase activity
GO:0044237	0.860	cellular metabolic process
GO:0051403	0.845	stress-activated MAPK cascade
GO:0007254	0.837	JNK cascade
GO:1901564	0.824	organonitrogen compound metabolic process
GO:0019538	0.813	protein metabolic process
GO:0036211	0.803	protein modification process
GO:0043410	0.791	positive regulation of MAPK cascade
GO:0051179	0.764	localization
GO:0016310	0.673	phosphorylation
GO:0051247	0.672	positive regulation of protein metabolic process
GO:0031325	0.649	positive regulation of cellular metabolic process
GO:0006468	0.603	protein phosphorylation
GO:0001934	0.535	positive regulation of protein phosphorylation
GO:0051640	0.505	organelle localization
GO:0044093	0.492	positive regulation of molecular function
GO:0048519	0.452	negative regulation of biological process
GO:0051648	0.424	vesicle localization
GO:0043085	0.352	positive regulation of catalytic activity
GO:0032872	0.345	regulation of stress-activated MAPK cascade
GO:0071840	0.337	cellular component organization or biogenesis
GO:0048523	0.337	negative regulation of cellular process
GO:0045860	0.334	positive regulation of protein kinase activity
GO:0016043	0.326	cellular component organization
GO:0032874	0.314	positive regulation of stress-activated MAPK cascade
GO:0043406	0.306	positive regulation of MAP kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016020	0.992	membrane
GO:0012505	0.988	endomembrane system
GO:0005829	0.965	cytosol
GO:0005794	0.964	Golgi apparatus
GO:0031090	0.945	organelle membrane
GO:0098588	0.553	bounding membrane of organelle
GO:0000139	0.321	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]