StarFunc result for job id Q12852

User Input

>input (859 residues)
MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTHVLQLHEQDAGGPGG
AAGSPESRASRVRADEVRLQCQSGSGFLEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEV
PFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVC
TQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSP
NMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVL
WELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQI
LLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIKSEGTCLHRLEEELVMRRREELR
HALDIREHYERKLERANNLYMELNALMLQLELKERELLRREQALERRCPGLLKPHPSRGL
LHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRS
RRGKTRHRKASAKGSCGDLPGLRTAVPPHEPGGPGSPGGLGGGPSAWEACPPALRGLHHD
LLLRKMSSSSPDLLSAALGSRGRGATGGAGDPGSPPPARGDTPPSEGSAPGSTSPDSPGG
AKGEPPPPVGPGEGVGLLGTGREGTSGRGGSRAGSQHLTPAALLYRAAVTRSQKRGISSE
EEEGEVDSEVELTSSQRWPQSLNMRQSLSTFSSENPSDGEEGTASEPSPSGTPEVGSTNT
DERPDERSDDMCSQGSEIPLDPPPSEVIPGPEPSSLPIPHQELLRERGPPNSEDSDCDST
ELDNSNSVDALRPPASLPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60700	0.498	0.482	0.000	888	0.955	0.923	Q60700.pdb.gz	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
2	AFDB:Q1HKZ5	0.404	0.365	9.288E-71	959	0.552	0.494	Q1HKZ5.pdb.gz	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
3	AFDB:O01700	0.319	0.296	3.888E-41	928	0.302	0.279	O01700.pdb.gz	DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans OX=6239 GN=dlk-1 PE=1 SV=4
4	AFDB:P80192	0.331	0.262	3.578E-32	1104	0.286	0.223	P80192.pdb.gz	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
5	AFDB:Q7T2V3	0.336	0.289	3.501E-31	1005	0.264	0.226	Q7T2V3.pdb.gz	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
6	AFDB:Q02779	0.322	0.291	1.065E-30	954	0.272	0.245	Q02779.pdb.gz	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
7	AFDB:A0A0G2JUN9	0.323	0.262	1.720E-29	1077	0.286	0.228	A0A0G2JUN9.pdb.gz	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
8	AFDB:Q95UN8	0.331	0.248	2.350E-28	1161	0.240	0.177	Q95UN8.pdb.gz	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
9	AFDB:F7BN18	0.267	0.205	1.173E-19	1128	0.194	0.148	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
10	AFDB:P09208	0.265	0.110	4.712E-19	2144	0.210	0.084	P09208.pdb.gz	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
11	PDB:2h8hA	0.270	0.505	2.002E-18	445	0.093	0.180	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.274	0.521	3.693E-18	441	0.095	0.186	1k9aB.pdb.gz
13	PDB:4fl2A	0.270	0.411	1.328E-17	555	0.092	0.142	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:7mfdA	0.266	0.537	2.893E-17	410	0.116	0.244	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
15	PDB:4k2rA	0.268	0.410	3.058E-17	551	0.084	0.131	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:4btfA	0.258	0.512	3.821E-17	413	0.093	0.194	4btfA.pdb.gz
17	PDB:6lk5A	0.260	0.791	5.220E-16	265	0.080	0.260	6lk5A.pdb.gz
18	PDB:8bfsA	0.263	0.742	9.627E-16	274	0.081	0.255	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
19	PDB:3eqdA	0.267	0.676	2.770E-15	315	0.085	0.232	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
20	PDB:6s73A	0.254	0.755	2.929E-15	269	0.069	0.219	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43283	0.0	773	966	0.553	0.492	M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens OX=9606 GN=MAP3K13 PE=1 SV=1
2	Q12852	0.0	1734	859	1.000	1.000	M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens OX=9606 GN=MAP3K12 PE=1 SV=2
3	Q1HKZ5	0.0	816	959	0.561	0.503	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
4	Q60700	0.0	1498	888	0.957	0.926	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
5	Q9VW24	1.35e-171	524	977	0.321	0.282	Q9VW24_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1
6	D3DMF6	1.96e-171	523	950	0.321	0.291	D3DMF6_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1
7	O01700	2.76e-118	383	928	0.234	0.217	DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans OX=6239 GN=dlk-1 PE=1 SV=4
8	Q02779	3.65e-76	269	954	0.175	0.157	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
9	D3ZG83	5.02e-76	268	940	0.176	0.161	M3K10_RAT Mitogen-activated protein kinase kinase kinase 10 OS=Rattus norvegicus OX=10116 GN=Map3k10 PE=1 SV=3
10	Q66L42	5.38e-76	268	940	0.176	0.161	M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus OX=10090 GN=Map3k10 PE=1 SV=2
11	P80192	2.24e-72	260	1104	0.166	0.130	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
12	F1LRA7	2.35e-72	260	1100	0.166	0.130	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
13	A0A0G2JUN9	2.50e-72	259	1078	0.166	0.133	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
14	Q80XI6	5.23e-72	256	850	0.172	0.174	M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus OX=10090 GN=Map3k11 PE=1 SV=1
15	Q66HA1	5.60e-72	255	850	0.172	0.174	M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus OX=10116 GN=Map3k11 PE=1 SV=1
16	Q16584	5.86e-72	255	847	0.172	0.175	M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens OX=9606 GN=MAP3K11 PE=1 SV=1
17	Q7T2V3	7.73e-72	257	1005	0.173	0.148	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
18	Q5TCX8	6.87e-66	241	1036	0.164	0.136	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
19	Q95UN8	8.10e-64	235	1161	0.159	0.118	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
20	D4Q8H0	1.94e-62	219	455	0.143	0.270	D4Q8H0_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=pk PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2.9e+02	11.9	ABC1 atypical kinase-like domain
2	PF01636 APH	5.9e+02	11.7	Phosphotransferase enzyme family
3	PF00069 Pkinase	1.2e-54	197.0	Protein kinase domain
4	PF17667 Pkinase_fungal	19	15.5	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	2.8e-58	208.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000005225

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000010648	0.948	Mitogen-activated protein kinase kinase 7
2	9601.ENSPPYP00000003821	0.766	Mitogen-activated protein kinase 8 interacting protein 1
3	9601.ENSPPYP00000024154	0.743	MYC binding protein 2, E3 ubiquitin protein ligase
4	9601.ENSPPYP00000023632	0.717	Belongs to the protein kinase superfamily.
5	9601.ENSPPYP00000013364	0.674	Mitogen-activated protein kinase 11
6	9601.ENSPPYP00000018500	0.654	Mitogen-activated protein kinase 14
7	9601.ENSPPYP00000017181	0.646	Uncharacterized protein
8	9601.ENSPPYP00000001051	0.587	threonyl-tRNA synthetase 2, mitochondrial (putative)
9	9601.ENSPPYP00000007749	0.587	threonyl-tRNA synthetase-like 2
10	9601.ENSPPYP00000001157	0.555	Thyroid stimulating hormone, beta
11	9601.ENSPPYP00000012468	0.541	mRNA export factor
12	9601.ENSPPYP00000006532	0.530	MAP3K12 binding inhibitory protein 1
13	9601.ENSPPYP00000006986	0.514	Delta-like 1 homolog (Drosophila)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.984	protein serine/threonine kinase activity
GO:0042802	0.773	identical protein binding
GO:0098772	0.736	molecular function regulator activity
GO:0030234	0.551	enzyme regulator activity
GO:0019207	0.482	kinase regulator activity
GO:0140677	0.475	molecular function activator activity
GO:0019887	0.456	protein kinase regulator activity
GO:0008047	0.436	enzyme activator activity
GO:0043539	0.401	protein serine/threonine kinase activator activity
GO:0019899	0.396	enzyme binding
GO:0042803	0.348	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0019222	0.987	regulation of metabolic process
GO:0019538	0.985	protein metabolic process
GO:0035556	0.985	intracellular signal transduction
GO:0048518	0.984	positive regulation of biological process
GO:0023051	0.983	regulation of signaling
GO:0010646	0.983	regulation of cell communication
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0033554	0.979	cellular response to stress
GO:0043412	0.977	macromolecule modification
GO:0006793	0.975	phosphorus metabolic process
GO:0000165	0.972	MAPK cascade
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0016310	0.968	phosphorylation
GO:0031098	0.968	stress-activated protein kinase signaling cascade
GO:0036211	0.967	protein modification process
GO:1902533	0.951	positive regulation of intracellular signal transduction
GO:0031323	0.950	regulation of cellular metabolic process
GO:0043408	0.949	regulation of MAPK cascade
GO:0007254	0.949	JNK cascade
GO:0010604	0.947	positive regulation of macromolecule metabolic process
GO:0006468	0.945	protein phosphorylation
GO:0043410	0.922	positive regulation of MAPK cascade
GO:0051173	0.899	positive regulation of nitrogen compound metabolic process
GO:0031325	0.897	positive regulation of cellular metabolic process
GO:0065009	0.494	regulation of molecular function
GO:0010468	0.481	regulation of gene expression
GO:0009889	0.469	regulation of biosynthetic process
GO:0048523	0.455	negative regulation of cellular process
GO:0019219	0.446	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.436	regulation of RNA metabolic process
GO:0051246	0.399	regulation of protein metabolic process
GO:0010556	0.395	regulation of macromolecule biosynthetic process
GO:0031326	0.395	regulation of cellular biosynthetic process
GO:0044093	0.391	positive regulation of molecular function
GO:0051247	0.391	positive regulation of protein metabolic process
GO:0031399	0.378	regulation of protein modification process
GO:0050790	0.352	regulation of catalytic activity
GO:0006355	0.316	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0005886	0.991	plasma membrane
GO:0005829	0.974	cytosol
GO:0043229	0.622	intracellular organelle
GO:0043231	0.303	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]