StarFunc result for job id Q12857

User Input

>input (509 residues)
MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDEL
LSEKPEVKQKWASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCL
RQADKVWRLDLVMVILFKGIPLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLA
YFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFSVTELVRVSQTPIAAGT
GPNFSLSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRLKSVEDEMDSPGEEPFYTGQGRS
PGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRAS
PHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPN
GSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPVPDTKPPTTSTEGGAASPTSPTYSTPST
SPANRFVSVGPRDPSFVNIPQQTQSWYLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AKN8	0.488	0.468	2.402E-65	532	0.982	0.940	B1AKN8.pdb.gz	B1AKN8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
2	AFDB:B1AKN7	0.556	0.605	7.218E-65	466	0.916	1.000	B1AKN7.pdb.gz	B1AKN7_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
3	AFDB:B1AKN5	0.419	0.437	7.397E-62	487	0.957	1.000	B1AKN5.pdb.gz	B1AKN5_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
4	AFDB:Q14938	0.501	0.507	8.226E-49	502	0.715	0.725	Q14938.pdb.gz	NFIX_HUMAN Nuclear factor 1 X-type OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=2
5	AFDB:A0A286YEX4	0.409	0.394	1.988E-41	530	0.629	0.604	A0A286YEX4.pdb.gz	A0A286YEX4_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=1
6	AFDB:P97863	0.434	0.389	5.654E-41	570	0.623	0.556	P97863.pdb.gz	NFIB_MOUSE Nuclear factor 1 B-type OS=Mus musculus OX=10090 GN=Nfib PE=1 SV=2
7	AFDB:C9JWJ8	0.423	0.527	4.575E-40	403	0.560	0.707	C9JWJ8.pdb.gz	C9JWJ8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=3
8	AFDB:A0A0R4IU09	0.439	0.513	4.833E-40	432	0.546	0.644	A0A0R4IU09.pdb.gz
9	AFDB:Q5VW27	0.435	0.453	1.840E-37	487	0.540	0.565	Q5VW27.pdb.gz	Q5VW27_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
10	AFDB:B8A4T4	0.358	0.888	2.211E-28	204	0.344	0.858	B8A4T4.pdb.gz
11	PDB:1h0nA	0.072	0.115	6.649	288	0.041	0.073	1h0nA.pdb.gz	Cobalt Substitution of Mouse R2 Ribonucleotide Reductase as a Model for Thereactive Diferrous State. Spectroscopic and Structural Evidence for a Ferromagnetically Coupled Dinuclear Cobalt Cluster
12	PDB:4xj6A	0.092	0.114	7.423	370	0.049	0.068	4xj6A.pdb.gz	Structural Basis for the Catalytic Mechanism of DncV, Bacterial Homolog of Cyclic GMP-AMP Synthase
13	PDB:4v6wCT	0.055	0.123	8.755	158	0.020	0.063	4v6wCT.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:2jr7A	0.047	0.178	9.773	84	0.024	0.143	2jr7A.pdb.gz	Solution structure of human DESR1, a CSL zinc-binding protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286YEX4	540	530	0.633	0.608	A0A286YEX4_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=1
2	A0A2R8Y7V8	535	566	0.607	0.546	A0A2R8Y7V8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
3	A0A590UK09	1029	508	0.990	0.992	A0A590UK09_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
4	A0A8I6AFY4	551	570	0.621	0.554	A0A8I6AFY4_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
5	A0A8J8YK50	561	503	0.635	0.642	A0A8J8YK50_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
6	B1AKN5	985	487	0.957	1.000	B1AKN5_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
7	B1AKN7	822	466	0.916	1.000	B1AKN7_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
8	B1AKN8	1021	532	0.982	0.940	B1AKN8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
9	C9JWJ8	622	460	0.660	0.730	C9JWJ8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=3
10	F7F711	532	491	0.607	0.629	F7F711_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
11	O70185	532	561	0.607	0.551	O70185_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=2
12	O70186	543	494	0.621	0.640	O70186_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=2
13	P08651	556	508	0.650	0.652	NFIC_HUMAN Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=2
14	P09414	1040	509	0.998	0.998	NFIA_RAT Nuclear factor 1 A-type OS=Rattus norvegicus OX=10116 GN=Nfia PE=1 SV=2
15	P70257	635	488	0.690	0.719	NFIX_MOUSE Nuclear factor 1 X-type OS=Mus musculus OX=10090 GN=Nfix PE=1 SV=2
16	P97863	551	570	0.621	0.554	NFIB_MOUSE Nuclear factor 1 B-type OS=Mus musculus OX=10090 GN=Nfib PE=1 SV=2
17	Q02780	1015	532	0.974	0.932	NFIA_MOUSE Nuclear factor 1 A-type OS=Mus musculus OX=10090 GN=Nfia PE=1 SV=1
18	Q12857	1041	509	1.000	1.000	NFIA_HUMAN Nuclear factor 1 A-type OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=2
19	Q14938	671	502	0.709	0.719	NFIX_HUMAN Nuclear factor 1 X-type OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=2
20	Q5VW26	554	570	0.623	0.556	Q5VW26_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00859 CTF_NFI	2.2e-114	393.7	CTF/NF-I family transcription modulation region
2	PF03165 MH1	4.7e-09	47.7	MH1 domain
3	PF10524 NfI_DNAbd_pre-N	3.5e-23	92.5	Nuclear factor I protein pre-N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008842654.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008844408.1	0.677	Krueppel-like factor 7 isoform X1
2	1026970.XP_008839028.1	0.650	Nicastrin
3	1026970.XP_008849090.1	0.631	SRY-box 9
4	1026970.XP_008848010.1	0.628	Presenilin-1
5	1026970.XP_008839593.1	0.624	Homeobox protein BarH-like 2
6	1026970.XP_008826261.1	0.619	Gamma-secretase subunit PEN-2
7	1026970.XP_008819832.1	0.602	Neurofibromin isoform X1
8	1026970.XP_008837371.1	0.569	CGRP receptor component
9	1026970.XP_008835996.1	0.565	Leucine-rich repeat transmembrane protein FLRT3
10	1026970.XP_008827573.1	0.551	DNA-directed RNA polymerase III subunit RPC7
11	1026970.XP_008834833.1	0.535	Ecdysoneless cell cycle regulator
12	1026970.XP_008849361.1	0.533	Brain-derived neurotrophic factor isoform X1
13	1026970.XP_008837993.1	0.525	V-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog
14	1026970.XP_008826806.1	0.521	Kruppel like factor 15
15	1026970.XP_008829768.1	0.521	Protein odd-skipped-related 2 isoform X1
16	1026970.XP_008820583.1	0.517	Presenilin 2
17	1026970.XP_008850162.1	0.517	Zinc finger protein AEBP2 isoform X1
18	1026970.XP_008821043.1	0.515	Zinc finger protein 274
19	1026970.XP_008834195.1	0.512	Oligodendrocyte transcription factor 2
20	1026970.XP_008850608.1	0.505	TNF receptor-associated factor 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000981	0.990	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.988	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.917	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.892	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.880	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.977	regulation of metabolic process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0031323	0.964	regulation of cellular metabolic process
GO:0009889	0.960	regulation of biosynthetic process
GO:0010468	0.947	regulation of gene expression
GO:0010556	0.941	regulation of macromolecule biosynthetic process
GO:0031326	0.940	regulation of cellular biosynthetic process
GO:0048518	0.916	positive regulation of biological process
GO:0006355	0.898	regulation of DNA-templated transcription
GO:0048522	0.883	positive regulation of cellular process
GO:0010604	0.880	positive regulation of macromolecule metabolic process
GO:0031325	0.845	positive regulation of cellular metabolic process
GO:0051173	0.844	positive regulation of nitrogen compound metabolic process
GO:0010557	0.838	positive regulation of macromolecule biosynthetic process
GO:0031328	0.835	positive regulation of cellular biosynthetic process
GO:0051254	0.753	positive regulation of RNA metabolic process
GO:0045893	0.730	positive regulation of DNA-templated transcription
GO:0009987	0.492	cellular process
GO:0050896	0.371	response to stimulus
GO:0006357	0.367	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.986	nucleoplasm
GO:0030054	0.866	cell junction
GO:0016020	0.452	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]