StarFunc result for job id Q12860

User Input

>input (1018 residues)
MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGK
VSLNCRARASPFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNY
GMVRSTEATLSFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPY
PADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIP
TIRWLKNGYAYHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGG
IYTCFAENNRGKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVW
SFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVV
RGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPIIE
GNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIKTDGAAPNVAPSDVGGGGGRN
RELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMSPSTAF
QVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESY
QIRYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFT
KKAPPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKH
SIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISGAPTLSPSLLGLLLPAFGILVYLEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QA12	0.477	0.469	0.000	1040	0.448	0.438	A0A2R8QA12.pdb.gz
2	AFDB:A4JYP8	0.395	0.390	0.000	1032	0.554	0.547	A4JYP8.pdb.gz	A4JYP8_DANRE Cntn1a OS=Danio rerio OX=7955 GN=F3 PE=1 SV=1
3	AFDB:B3DH04	0.616	0.606	0.000	1040	0.483	0.473	B3DH04.pdb.gz
4	AFDB:O94779	0.663	0.622	0.000	1100	0.449	0.415	O94779.pdb.gz	CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CNTN5 PE=1 SV=2
5	AFDB:P14781	0.795	0.801	0.000	1010	0.769	0.775	P14781.pdb.gz	CNTN1_CHICK Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 PE=1 SV=1
6	AFDB:P22063	0.750	0.736	0.000	1040	0.502	0.491	P22063.pdb.gz	CNTN2_RAT Contactin-2 OS=Rattus norvegicus OX=10116 GN=Cntn2 PE=1 SV=1
7	AFDB:P28685	0.737	0.725	0.000	1036	0.500	0.491	P28685.pdb.gz	CNTN2_CHICK Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 PE=1 SV=1
8	AFDB:P97528	0.505	0.501	0.000	1028	0.413	0.409	P97528.pdb.gz	CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 GN=Cntn6 PE=1 SV=1
9	AFDB:Q62682	0.546	0.543	0.000	1028	0.435	0.431	Q62682.pdb.gz	CNTN3_RAT Contactin-3 OS=Rattus norvegicus OX=10116 GN=Cntn3 PE=1 SV=1
10	AFDB:Q62845	0.512	0.508	0.000	1026	0.429	0.426	Q62845.pdb.gz	CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4 PE=1 SV=1
11	PDB:5oj2B	0.141	0.186	2.702E-29	692	0.134	0.197	5oj2B.pdb.gz
12	PDB:1e07A	0.142	0.201	6.700E-20	642	0.109	0.173	1e07A.pdb.gz
13	PDB:7sqcO0	0.155	0.143	7.199E-18	1140	0.098	0.088	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:5a42A	0.113	0.083	1.004E-14	1597	0.113	0.072	5a42A.pdb.gz
15	PDB:6dldD	0.152	0.520	1.574E-14	269	0.069	0.260	6dldD.pdb.gz
16	PDB:7q1yA	0.108	0.092	5.068E-14	1374	0.080	0.059	7q1yA.pdb.gz
17	PDB:7q5zA	0.118	0.094	3.351E-13	1344	0.060	0.045	7q5zA.pdb.gz
18	PDB:6dlfA	0.159	0.609	1.936E-12	236	0.053	0.229	6dlfA.pdb.gz
19	PDB:6pxvA	0.105	0.126	3.800E-12	823	0.056	0.069	6pxvA.pdb.gz
20	PDB:7vonA	0.141	0.114	7.461E-12	1399	0.093	0.068	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4JYP8	0.0	1134	1032	0.552	0.545	A4JYP8_DANRE Cntn1a OS=Danio rerio OX=7955 GN=F3 PE=1 SV=1
2	O94779	0.0	897	1100	0.444	0.411	CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CNTN5 PE=1 SV=2
3	P12960	0.0	1981	1020	0.954	0.952	CNTN1_MOUSE Contactin-1 OS=Mus musculus OX=10090 GN=Cntn1 PE=1 SV=1
4	P14781	0.0	1610	1010	0.771	0.777	CNTN1_CHICK Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 PE=1 SV=1
5	P22063	0.0	927	1040	0.492	0.482	CNTN2_RAT Contactin-2 OS=Rattus norvegicus OX=10116 GN=Cntn2 PE=1 SV=1
6	P28685	0.0	956	1036	0.505	0.496	CNTN2_CHICK Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 PE=1 SV=1
7	P68500	0.0	878	1098	0.436	0.404	CNTN5_MOUSE Contactin-5 OS=Mus musculus OX=10090 GN=Cntn5 PE=1 SV=2
8	P97528	0.0	815	1028	0.417	0.413	CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 GN=Cntn6 PE=1 SV=1
9	Q02246	0.0	941	1040	0.494	0.484	CNTN2_HUMAN Contactin-2 OS=Homo sapiens OX=9606 GN=CNTN2 PE=1 SV=1
10	Q12860	0.0	2110	1018	1.000	1.000	CNTN1_HUMAN Contactin-1 OS=Homo sapiens OX=9606 GN=CNTN1 PE=1 SV=1
11	Q61330	0.0	936	1040	0.495	0.485	CNTN2_MOUSE Contactin-2 OS=Mus musculus OX=10090 GN=Cntn2 PE=1 SV=2
12	Q62682	0.0	881	1028	0.443	0.439	CNTN3_RAT Contactin-3 OS=Rattus norvegicus OX=10116 GN=Cntn3 PE=1 SV=1
13	Q62845	0.0	867	1026	0.433	0.430	CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4 PE=1 SV=1
14	Q63198	0.0	1977	1021	0.938	0.935	CNTN1_RAT Contactin-1 OS=Rattus norvegicus OX=10116 GN=Cntn1 PE=1 SV=2
15	Q8IWV2	0.0	879	1026	0.439	0.436	CNTN4_HUMAN Contactin-4 OS=Homo sapiens OX=9606 GN=CNTN4 PE=1 SV=1
16	Q9JMB8	0.0	805	1028	0.417	0.413	CNTN6_MOUSE Contactin-6 OS=Mus musculus OX=10090 GN=Cntn6 PE=1 SV=2
17	Q9P232	0.0	881	1028	0.428	0.424	CNTN3_HUMAN Contactin-3 OS=Homo sapiens OX=9606 GN=CNTN3 PE=1 SV=3
18	Q9UQ52	0.0	822	1028	0.415	0.411	CNTN6_HUMAN Contactin-6 OS=Homo sapiens OX=9606 GN=CNTN6 PE=1 SV=1
19	Q9W675	0.0	944	1040	0.481	0.471	Q9W675_DANRE Contactin-2 precursor OS=Danio rerio OX=7955 GN=tag1 PE=1 SV=1
20	Q9VN14	1.12e-135	444	1390	0.315	0.231	CONT_DROME Contactin OS=Drosophila melanogaster OX=7227 GN=Cont PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	4.6	18.4	Adenovirus E3 region protein CR1
2	PF13754 Big_3_4	75	14.5	Domain of unknown function
3	PF08205 C2-set_2	0.81	21.1	CD80-like C2-set immunoglobulin domain
4	PF00041 fn3	2.6e-37	138.4	Fibronectin type III domain
5	PF20418 Herpes_gE_N	35	15.7	Alphaherpesvirus glycoprotein E N-terminal
6	PF07679 I-set	5.8e-58	204.3	Immunoglobulin I-set domain
7	PF00047 ig	2.3e-42	154.4	Immunoglobulin domain
8	PF13895 Ig_2	1.1e-45	165.1	Immunoglobulin domain
9	PF13927 Ig_3	4e-68	237.3	Immunoglobulin domain
10	PF16680 Ig_4	0.00015	33.6	T-cell surface glycoprotein CD3 delta chain
11	PF16681 Ig_5	1.6e-07	43.0	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
12	PF18452 Ig_6	0.016	26.5	Immunoglobulin domain
13	PF17736 Ig_C17orf99	0.23	22.9	C17orf99 Ig domain
14	PF09294 Interfer-bind	2.2e+02	13.6	Interferon-alpha/beta receptor, fibronectin type III
15	PF16706 Izumo-Ig	0.0072	27.6	Izumo-like Immunoglobulin domain
16	PF16656 Pur_ac_phosph_N	0.00029	32.7	Purple acid Phosphatase, N-terminal domain
17	PF11465 Receptor_2B4	0.47	22.0	Natural killer cell receptor 2B4
18	PF01108 Tissue_fac	1	20.6	Tissue factor
19	PF07686 V-set	2.5e-22	90.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000447006

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377047	0.998	Receptor-type tyrosine-protein phosphatase zeta
2	9606.ENSP00000264638	0.997	Contactin-associated protein 1
3	9606.ENSP00000277541	0.988	Neurogenic locus notch homolog protein 1
4	9606.ENSP00000354778	0.944	Contactin-associated protein-like 2
5	9606.ENSP00000256646	0.943	Neurogenic locus notch homolog protein 2
6	9606.ENSP00000326366	0.908	Presenilin-1
7	9606.ENSP00000355747	0.905	Presenilin-2
8	9606.ENSP00000294785	0.902	Nicastrin
9	9606.ENSP00000261879	0.900	Gamma-secretase subunit APH-1B
10	9606.ENSP00000358105	0.900	Gamma-secretase subunit APH-1A
11	9606.ENSP00000468411	0.900	Gamma-secretase subunit PEN-2
12	9606.ENSP00000359077	0.892	Neural cell adhesion molecule L1
13	9606.ENSP00000368314	0.891	Neuronal cell adhesion molecule
14	9606.ENSP00000344786	0.883	Neurofascin
15	9606.ENSP00000334928	0.816	Receptor-type tyrosine-protein phosphatase beta
16	9606.ENSP00000257600	0.792	E3 ubiquitin-protein ligase DTX1
17	9606.ENSP00000367817	0.763	Podocalyxin
18	9606.ENSP00000320176	0.743	Hematopoietic lineage cell-specific protein
19	9606.ENSP00000416293	0.697	Solute carrier family 2, facilitated glucose transporter member 1
20	9606.ENSP00000302100	0.688	Galectin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0009987	0.990	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0048518	0.878	positive regulation of biological process
GO:0019222	0.813	regulation of metabolic process
GO:0048856	0.810	anatomical structure development
GO:0032501	0.807	multicellular organismal process
GO:0060255	0.791	regulation of macromolecule metabolic process
GO:0048522	0.763	positive regulation of cellular process
GO:0071840	0.736	cellular component organization or biogenesis
GO:0080090	0.721	regulation of primary metabolic process
GO:0051171	0.721	regulation of nitrogen compound metabolic process
GO:0016043	0.712	cellular component organization
GO:0007275	0.700	multicellular organism development
GO:0048731	0.620	system development
GO:0051246	0.588	regulation of protein metabolic process
GO:0050896	0.569	response to stimulus
GO:0007399	0.529	nervous system development
GO:0031323	0.388	regulation of cellular metabolic process
GO:0030154	0.385	cell differentiation
GO:0030030	0.376	cell projection organization
GO:0051174	0.354	regulation of phosphorus metabolic process
GO:0120036	0.333	plasma membrane bounded cell projection organization
GO:0042325	0.327	regulation of phosphorylation
GO:0009893	0.321	positive regulation of metabolic process
GO:0031399	0.312	regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.941	organelle
GO:0043227	0.892	membrane-bounded organelle
GO:0005622	0.769	intracellular anatomical structure
GO:0005576	0.708	extracellular region
GO:0043229	0.665	intracellular organelle
GO:0043231	0.654	intracellular membrane-bounded organelle
GO:0031982	0.614	vesicle
GO:0005737	0.575	cytoplasm
GO:1903561	0.379	extracellular vesicle
GO:0005615	0.335	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]