StarFunc result for job id Q12866

User Input

>input (999 residues)
MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQ
PALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVP
NIYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKIN
NEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNE
QPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSI
LISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVS
CMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGY
RISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFI
PAHGWVDYAPSSTPAPGNADPVLIIFGCFCGFILIGLILYISLAIRKRVQETKFGNAFTE
EDSELVVNYIAKKSFCRRAIELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGS
VMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMS
SQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFL
HRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSK
SDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTD
PLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPD
SIIASCTPRAAISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGE
RLVRNGVSWSHSSMLPLGSSLPDELLFADDSSEGSEVLM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12866	0.999	0.999	0.000	999	1.000	1.000	Q12866.pdb.gz	MERTK_HUMAN Tyrosine-protein kinase Mer OS=Homo sapiens OX=9606 GN=MERTK PE=1 SV=2
2	AFDB:E9PSX9	0.326	0.368	2.505E-94	879	0.370	0.421	E9PSX9.pdb.gz	E9PSX9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
3	AFDB:Q00993	0.323	0.362	3.266E-94	888	0.372	0.419	Q00993.pdb.gz	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
4	AFDB:Q06418	0.472	0.519	4.037E-94	890	0.358	0.402	Q06418.pdb.gz	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
5	AFDB:E9PSY0	0.329	0.368	3.115E-92	888	0.374	0.421	E9PSY0.pdb.gz	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
6	AFDB:P55144	0.469	0.521	3.208E-91	880	0.355	0.403	P55144.pdb.gz	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
7	AFDB:Q9YI66	0.332	0.375	3.966E-91	874	0.350	0.400	Q9YI66.pdb.gz	TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio OX=7955 GN=tyro3 PE=2 SV=1
8	AFDB:P35590	0.264	0.232	7.941E-53	1138	0.189	0.166	P35590.pdb.gz	TIE1_HUMAN Tyrosine-protein kinase receptor Tie-1 OS=Homo sapiens OX=9606 GN=TIE1 PE=1 SV=1
9	AFDB:Q1LVG4	0.260	0.195	5.447E-46	1348	0.202	0.150	Q1LVG4.pdb.gz	Q1LVG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRb PE=1 SV=3
10	AFDB:F1QNX5	0.268	0.199	1.085E-45	1353	0.198	0.146	F1QNX5.pdb.gz
11	PDB:1k9aB	0.245	0.544	9.100E-22	441	0.101	0.229	1k9aB.pdb.gz
12	PDB:2h8hA	0.240	0.519	7.190E-21	445	0.101	0.227	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.246	0.435	1.099E-20	555	0.099	0.178	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.244	0.434	4.037E-19	551	0.088	0.160	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:2qkwB	0.237	0.746	5.885E-17	292	0.074	0.253	2qkwB.pdb.gz
16	PDB:6pxvA	0.145	0.170	7.106E-16	823	0.052	0.063	6pxvA.pdb.gz
17	PDB:2bujA	0.236	0.758	8.784E-16	291	0.067	0.230	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
18	PDB:4rerA	0.238	0.498	9.262E-16	459	0.069	0.150	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:6lk5A	0.234	0.821	1.207E-15	265	0.068	0.257	6lk5A.pdb.gz
20	PDB:4zhxA	0.241	0.562	1.273E-15	409	0.062	0.152	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K2H0	0.0	655	879	0.377	0.429	A0A0G2K2H0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
2	E9PSX9	0.0	626	858	0.360	0.420	E9PSX9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
3	E9PSY0	0.0	649	921	0.382	0.415	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
4	P30530	0.0	665	894	0.392	0.438	UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL PE=1 SV=4
5	P55144	0.0	622	880	0.342	0.389	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
6	P55146	0.0	623	880	0.341	0.388	TYRO3_RAT Tyrosine-protein kinase receptor TYRO3 OS=Rattus norvegicus OX=10116 GN=Tyro3 PE=1 SV=1
7	P57097	0.0	1664	994	0.796	0.800	MERTK_RAT Tyrosine-protein kinase Mer OS=Rattus norvegicus OX=10116 GN=Mertk PE=2 SV=1
8	Q00993	0.0	654	888	0.374	0.421	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
9	Q06418	0.0	629	890	0.344	0.387	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
10	Q12866	0.0	2066	999	1.000	1.000	MERTK_HUMAN Tyrosine-protein kinase Mer OS=Homo sapiens OX=9606 GN=MERTK PE=1 SV=2
11	Q60805	0.0	1657	994	0.801	0.805	MERTK_MOUSE Tyrosine-protein kinase Mer OS=Mus musculus OX=10090 GN=Mertk PE=1 SV=1
12	Q8VI99	0.0	653	879	0.378	0.430	Q8VI99_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=3 SV=1
13	Q8VIA0	0.0	655	888	0.378	0.426	Q8VIA0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=3 SV=1
14	Q9YI66	0.0	588	874	0.343	0.392	TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio OX=7955 GN=tyro3 PE=2 SV=1
15	P16056	1.12e-68	253	1379	0.141	0.102	MET_MOUSE Hepatocyte growth factor receptor OS=Mus musculus OX=10090 GN=Met PE=1 SV=1
16	P08581	4.14e-68	251	1390	0.139	0.100	MET_HUMAN Hepatocyte growth factor receptor OS=Homo sapiens OX=9606 GN=MET PE=1 SV=4
17	F1QLR7	5.50e-68	251	1382	0.132	0.096	F1QLR7_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=c-met PE=4 SV=1
18	P97523	8.41e-67	247	1382	0.140	0.101	MET_RAT Hepatocyte growth factor receptor OS=Rattus norvegicus OX=10116 GN=Met PE=1 SV=1
19	Q64GK4	1.98e-65	243	1382	0.129	0.093	Q64GK4_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=cmet PE=2 SV=1
20	Q05688	7.48e-65	233	640	0.168	0.263	IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus OX=9913 GN=IGF1R PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	73	15.1	Immunoglobulin C1-set domain
2	PF16117 DUF4833	7.7e+02	11.6	Domain of unknown function (DUF4833)
3	PF00041 fn3	2.9e-09	48.5	Fibronectin type III domain
4	PF07679 I-set	1.5e-08	45.9	Immunoglobulin I-set domain
5	PF00047 ig	1.3e-08	46.2	Immunoglobulin domain
6	PF13895 Ig_2	4e-08	44.8	Immunoglobulin domain
7	PF13927 Ig_3	3.6e-12	58.0	Immunoglobulin domain
8	PF18452 Ig_6	35	15.7	Immunoglobulin domain
9	PF00069 Pkinase	4.2e-33	126.4	Protein kinase domain
10	PF17667 Pkinase_fungal	2.5e+02	11.8	Fungal protein kinase
11	PF07714 PK_Tyr_Ser-Thr	1.8e-87	304.5	Protein tyrosine and serine/threonine kinase
12	PF07686 V-set	0.073	24.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295408

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331831	0.997	Growth arrest-specific protein 6
2	9606.ENSP00000377783	0.988	Vitamin K-dependent protein S
3	9606.ENSP00000229771	0.963	Tubby-related protein 1
4	9606.ENSP00000254301	0.963	Galectin-3
5	9606.ENSP00000274532	0.903	T-cell immunoglobulin and mucin domain-containing protein 4
6	9606.ENSP00000274473	0.780	Multiple epidermal growth factor-like domains protein 10
7	9606.ENSP00000262340	0.763	Retinoid isomerohydrolase
8	9606.ENSP00000268150	0.756	Lactadherin
9	9606.ENSP00000376345	0.752	Growth factor receptor-bound protein 2
10	9606.ENSP00000358165	0.734	High affinity immunoglobulin gamma Fc receptor I
11	9606.ENSP00000399709	0.721	Bestrophin-1
12	9606.ENSP00000386647	0.720	Pejvakin
13	9606.ENSP00000369581	0.644	Interferon beta
14	9606.ENSP00000268125	0.639	Retinaldehyde-binding protein 1
15	9606.ENSP00000356370	0.626	Protein crumbs homolog 1
16	9606.ENSP00000337224	0.625	Lecithin retinol acyltransferase
17	9606.ENSP00000262101	0.622	Macrophage scavenger receptor types I and II
18	9606.ENSP00000351059	0.622	CX3C chemokine receptor 1
19	9606.ENSP00000449079	0.614	Retinol dehydrogenase 12
20	9606.ENSP00000430945	0.613	Adhesion G protein-coupled receptor B1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004714	0.997	transmembrane receptor protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0051716	0.940	cellular response to stimulus
GO:0007154	0.897	cell communication
GO:0023052	0.892	signaling
GO:0007165	0.846	signal transduction
GO:0071704	0.803	organic substance metabolic process
GO:0044238	0.772	primary metabolic process
GO:0048519	0.768	negative regulation of biological process
GO:0051179	0.752	localization
GO:0044237	0.748	cellular metabolic process
GO:0006909	0.735	phagocytosis
GO:0032501	0.728	multicellular organismal process
GO:0048523	0.716	negative regulation of cellular process
GO:0006807	0.669	nitrogen compound metabolic process
GO:0032502	0.665	developmental process
GO:0043170	0.645	macromolecule metabolic process
GO:0048856	0.626	anatomical structure development
GO:1901564	0.579	organonitrogen compound metabolic process
GO:0048522	0.566	positive regulation of cellular process
GO:0006793	0.563	phosphorus metabolic process
GO:0019538	0.561	protein metabolic process
GO:0006796	0.552	phosphate-containing compound metabolic process
GO:0007166	0.417	cell surface receptor signaling pathway
GO:0043412	0.394	macromolecule modification
GO:0051239	0.383	regulation of multicellular organismal process
GO:0051049	0.383	regulation of transport
GO:0036211	0.345	protein modification process
GO:0030154	0.336	cell differentiation
GO:0016310	0.332	phosphorylation
GO:0060627	0.317	regulation of vesicle-mediated transport
GO:0006468	0.304	protein phosphorylation
GO:0048583	0.302	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043227	0.997	membrane-bounded organelle
GO:0005886	0.992	plasma membrane
GO:0005737	0.988	cytoplasm
GO:0005576	0.920	extracellular region
GO:0043229	0.817	intracellular organelle
GO:0005615	0.807	extracellular space
GO:0043231	0.770	intracellular membrane-bounded organelle
GO:0042995	0.359	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.997	receptor protein-tyrosine kinase.

[back to server]