StarFunc result for job id Q12870

User Input

>input (199 residues)
MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRGPGPGGGRRAG
GGGGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSY
IAHLANVLLLGDSADDGQPCFRAAGSAKGAVPAAADGGRQPRSICTFCLSNQRKGGGRRD
LGGSCLKVRGVAPLRGPRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12870	1.000	1.000	1.684E-29	199	1.000	1.000	Q12870.pdb.gz	TCF15_HUMAN Transcription factor 15 OS=Homo sapiens OX=9606 GN=TCF15 PE=2 SV=3
2	AFDB:Q1LXV2	0.499	0.499	2.311E-14	199	0.492	0.492	Q1LXV2.pdb.gz
3	AFDB:P59101	0.515	0.542	3.330E-14	187	0.497	0.529	P59101.pdb.gz	SCX_CHICK Basic helix-loop-helix transcription factor scleraxis OS=Gallus gallus OX=9031 GN=SCX PE=2 SV=1
4	AFDB:E7F361	0.509	0.506	3.996E-14	200	0.462	0.460	E7F361.pdb.gz
5	AFDB:B5DFF0	0.376	0.335	6.619E-12	228	0.558	0.487	B5DFF0.pdb.gz	B5DFF0_RAT Scx protein OS=Rattus norvegicus OX=10116 GN=Scx PE=2 SV=1
6	AFDB:Q59E67	0.425	0.546	3.139E-7	150	0.307	0.407	Q59E67.pdb.gz	Q59E67_DROME BHLH domain-containing protein OS=Drosophila melanogaster OX=7227 GN=CG12648 PE=4 SV=1
7	AFDB:Q0IGT4	0.355	0.373	1.540E-5	189	0.251	0.265	Q0IGT4.pdb.gz	Q0IGT4_DROME Cousin of atonal OS=Drosophila melanogaster OX=7227 GN=cato PE=2 SV=1
8	AFDB:O60682	0.310	0.300	2.663E-5	206	0.296	0.286	O60682.pdb.gz	MUSC_HUMAN Musculin OS=Homo sapiens OX=9606 GN=MSC PE=1 SV=2
9	AFDB:Q32PV5	0.290	0.325	7.489E-5	176	0.226	0.256	Q32PV5.pdb.gz	TCF21_DANRE Transcription factor 21 OS=Danio rerio OX=7955 GN=tcf21 PE=2 SV=1
10	AFDB:Q02575	0.273	0.401	8.458E-5	133	0.246	0.368	Q02575.pdb.gz	HEN1_HUMAN Helix-loop-helix protein 1 OS=Homo sapiens OX=9606 GN=NHLH1 PE=1 SV=1
11	PDB:7ktrE	0.101	0.147	4.293	124	0.065	0.105	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
12	PDB:5ay8A	0.114	0.224	5.152	97	0.065	0.134	5ay8A.pdb.gz	Structure and function of human histone H3.Y nucleosome
13	PDB:7ok0K	0.085	0.146	5.152	86	0.065	0.151	7ok0K.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
14	PDB:4h9sA	0.119	0.242	5.819	89	0.070	0.157	4h9sA.pdb.gz
15	PDB:7r72w	0.154	0.160	5.819	189	0.080	0.085	7r72w.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
16	PDB:3ojaA	0.246	0.114	6.984	482	0.030	0.012	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
17	PDB:3rgkA	0.140	0.178	6.984	149	0.045	0.060	3rgkA.pdb.gz	X-ray crystal structure of a recombinant human myoglobin mutant at 2.8 A resolution
18	PDB:4v6wAR	0.154	0.225	6.984	120	0.055	0.092	4v6wAR.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:4v8sAY	0.149	0.095	7.422	376	0.050	0.027	4v8sAY.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
20	PDB:6iczM	0.084	0.115	7.422	130	0.075	0.115	6iczM.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12870	7.76e-141	392	199	1.000	1.000	TCF15_HUMAN Transcription factor 15 OS=Homo sapiens OX=9606 GN=TCF15 PE=2 SV=3
2	Q60756	3.83e-126	355	195	0.925	0.944	TCF15_MOUSE Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2
3	P59101	1.26e-56	179	187	0.503	0.535	SCX_CHICK Basic helix-loop-helix transcription factor scleraxis OS=Gallus gallus OX=9031 GN=SCX PE=2 SV=1
4	Q64124	1.53e-46	154	207	0.548	0.527	SCX_MOUSE Basic helix-loop-helix transcription factor scleraxis OS=Mus musculus OX=10090 GN=Scx PE=1 SV=1
5	Q7RTU7	1.74e-45	151	201	0.563	0.557	SCX_HUMAN Basic helix-loop-helix transcription factor scleraxis OS=Homo sapiens OX=9606 GN=SCX PE=1 SV=1
6	B5DFF0	3.17e-45	151	228	0.538	0.469	B5DFF0_RAT Scx protein OS=Rattus norvegicus OX=10116 GN=Scx PE=2 SV=1
7	Q59E67	2.53e-24	95.5	150	0.271	0.360	Q59E67_DROME BHLH domain-containing protein OS=Drosophila melanogaster OX=7227 GN=CG12648 PE=4 SV=1
8	Q6GNB7	9.15e-16	73.6	179	0.216	0.240	TCF21_XENLA Transcription factor 21 OS=Xenopus laevis OX=8355 GN=tcf21 PE=2 SV=1
9	P57102	1.92e-15	73.6	208	0.171	0.163	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
10	Q9VL05	2.35e-15	72.4	174	0.166	0.190	Q9VL05_DROME FI14601p OS=Drosophila melanogaster OX=7227 GN=Hand PE=2 SV=3
11	P61295	4.80e-15	72.8	217	0.186	0.171	HAND2_RAT Heart- and neural crest derivatives-expressed protein 2 OS=Rattus norvegicus OX=10116 GN=Hand2 PE=2 SV=1
12	P61296	4.80e-15	72.8	217	0.186	0.171	HAND2_HUMAN Heart- and neural crest derivatives-expressed protein 2 OS=Homo sapiens OX=9606 GN=HAND2 PE=1 SV=1
13	Q61039	4.80e-15	72.8	217	0.186	0.171	HAND2_MOUSE Heart- and neural crest derivatives-expressed protein 2 OS=Mus musculus OX=10090 GN=Hand2 PE=1 SV=3
14	Q90690	5.93e-15	72.4	216	0.241	0.222	HAND2_CHICK Heart- and neural crest derivatives-expressed protein 2 OS=Gallus gallus OX=9031 GN=HAND2 PE=2 SV=1
15	P97831	8.25e-15	70.9	160	0.206	0.256	TWST2_RAT Twist-related protein 2 OS=Rattus norvegicus OX=10116 GN=Twist2 PE=2 SV=2
16	Q8WVJ9	8.25e-15	70.9	160	0.206	0.256	TWST2_HUMAN Twist-related protein 2 OS=Homo sapiens OX=9606 GN=TWIST2 PE=1 SV=1
17	Q9D030	8.88e-15	70.5	160	0.206	0.256	TWST2_MOUSE Twist-related protein 2 OS=Mus musculus OX=10090 GN=Twist2 PE=1 SV=1
18	O43680	9.46e-15	70.9	179	0.221	0.246	TCF21_HUMAN Transcription factor 21 OS=Homo sapiens OX=9606 GN=TCF21 PE=1 SV=2
19	P13903	1.01e-14	70.5	166	0.216	0.259	TWIST_XENLA Twist-related protein OS=Xenopus laevis OX=8355 GN=twist1 PE=2 SV=1
20	O96004	1.99e-14	70.9	215	0.241	0.223	HAND1_HUMAN Heart- and neural crest derivatives-expressed protein 1 OS=Homo sapiens OX=9606 GN=HAND1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1.8e-13	61.6	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246080

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000027335	0.926	Cadherin-17
2	9606.ENSP00000262041	0.751	Homeobox protein MOX-2
3	9606.ENSP00000364946	0.738	Homeobox protein Mohawk
4	9606.ENSP00000381499	0.677	Paired box protein Pax-1
5	9606.ENSP00000351497	0.672	Low affinity immunoglobulin gamma Fc region receptor II-b
6	9606.ENSP00000268613	0.668	Cadherin-13
7	9606.ENSP00000326371	0.660	Forkhead box protein C2
8	9606.ENSP00000321684	0.654	Homeobox protein MOX-1
9	9606.ENSP00000371786	0.653	One cut domain family member 3
10	9606.ENSP00000315371	0.652	Anoctamin-5
11	9606.ENSP00000381768	0.648	Cadherin-23
12	9606.ENSP00000357516	0.645	Tropomyosin alpha-3 chain
13	9606.ENSP00000380308	0.625	Cytoplasmic dynein 1 intermediate chain 2
14	9606.ENSP00000370256	0.623	Forkhead box protein C1
15	9606.ENSP00000261769	0.599	Cadherin-1
16	9606.ENSP00000378650	0.598	T-box transcription factor TBX6
17	9606.ENSP00000363068	0.593	Protocadherin-15
18	9606.ENSP00000271450	0.583	Low affinity immunoglobulin gamma Fc region receptor II-a
19	9606.ENSP00000263645	0.581	CD81 antigen
20	9606.ENSP00000257189	0.567	Desmoglein-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0005515	0.998	protein binding
GO:0003677	0.995	DNA binding
GO:0043565	0.989	sequence-specific DNA binding
GO:0003690	0.989	double-stranded DNA binding
GO:1990837	0.979	sequence-specific double-stranded DNA binding
GO:0000976	0.845	transcription cis-regulatory region binding
GO:0000977	0.627	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.446	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0048856	0.982	anatomical structure development
GO:0019222	0.937	regulation of metabolic process
GO:0010468	0.933	regulation of gene expression
GO:0006355	0.897	regulation of DNA-templated transcription
GO:0006357	0.851	regulation of transcription by RNA polymerase II
GO:0007498	0.678	mesoderm development
GO:0009987	0.607	cellular process
GO:0048518	0.558	positive regulation of biological process
GO:0032501	0.480	multicellular organismal process
GO:0048522	0.452	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0032991	0.991	protein-containing complex
GO:0005667	0.626	transcription regulator complex
GO:0071944	0.449	cell periphery
GO:0005886	0.439	plasma membrane
GO:0070013	0.316	intracellular organelle lumen
GO:0031981	0.310	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]