StarFunc result for job id Q12872

User Input

>input (951 residues)
MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDERALAQEQGQHL
IPWMGDHKILIDRYDGRGHLHDLSEYDAEYSTWNRDYQLSEEEARIEALCDEERYLALHT
DLLEEEARQEEEYKRLSEALAEDGSYNAVGFTYGSDYYDPSEPTEEEEPSKQREKNEAEN
LEENEEPFVAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQF
DFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVSSDNEDDDDEEDGNYLHPS
LFASKKCNRLEELMKPLKVVDPDHPLAALVRKAQADSSTPTPHNADGAPVQPSQVEYTAD
STVAAMYYSYYMLPDGTYCLAPPPPGIDVTTYYSTLPAGVTVSNSPGVTTTAPPPPGTTP
LPPPTTAETSSGATSTTTTTSALAPVAAIIPPPPDVQPVIDKLAEYVARNGLKFETSVRA
KNDQRFEFLQPWHQYNAYYEFKKQFFLQKEGGDSMQAVSAPEEAPTDSAPEKPSDAGEDG
APEDAAEVGARAGSGGKKEASSSKTVPDGKLVKASFAPISFAIKAKENDLLPLEKNRVKL
DDDSDDDEESKEGQESSSSAANTNPAVAPPCVVVEEKKPQLTQEELEAKQAKQKLEDRLA
AAAREKLAQASKESKEKQLQAERKRKAALFLQTLKNPLPEAEAGKIEESPFSVEESSTTP
CPLLTGGRPLPTLEVKPPDRPSSKSKDPPREEEKEKKKKKHKKRSRTRSRSPKYHSSSKS
RSRSHSKAKHSLPSAYRTVRRSRSRSRSPRRRAHSPERRREERSVPTAYRVSRSPGASRK
RTRSRSPHEKKKKRRSRSRTKSKARSQSVSPSKQAAPRPAAPAAHSAHSASVSPVESRGS
SQERSRGVSQEKEAQISSAIVSSVQSKITQDLMAKVRAMLAASKNLQTSAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZTQ1	0.162	0.162	0.000	945	0.890	0.895	D3ZTQ1.pdb.gz	SFSWA_RAT Splicing factor, suppressor of white-apricot homolog OS=Rattus norvegicus OX=10116 GN=Sfswap PE=1 SV=1
2	AFDB:Q12872	1.000	1.000	0.000	951	1.000	1.000	Q12872.pdb.gz	SFSWA_HUMAN Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3
3	AFDB:Q9I7D3	0.067	0.066	5.492E-4	961	0.146	0.145	Q9I7D3.pdb.gz	CAPR1_DROME Caprin homolog OS=Drosophila melanogaster OX=7227 GN=Capr PE=1 SV=1
4	PDB:6ff7p	0.062	0.330	1.291E-3	175	0.039	0.211	6ff7p.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
5	AFDB:B0V0H4	0.052	0.047	2.233E-3	1071	0.090	0.080	B0V0H4.pdb.gz
6	AFDB:O13736	0.052	0.039	7.187E-3	1420	0.121	0.081	O13736.pdb.gz	SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sla1 PE=1 SV=1
7	AFDB:A0A0F7NGI8	0.044	0.050	9.626E-3	752	0.115	0.145	A0A0F7NGI8.pdb.gz	A0A0F7NGI8_HUMAN Leucine rich repeat (In FLII) interacting protein 1, isoform CRA_c OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=2 SV=1
8	AFDB:Q32MZ4	0.048	0.051	9.626E-3	808	0.128	0.151	Q32MZ4.pdb.gz	LRRF1_HUMAN Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2
9	AFDB:O35607	0.043	0.041	1.021E-2	1038	0.087	0.080	O35607.pdb.gz	BMPR2_MOUSE Bone morphogenetic protein receptor type-2 OS=Mus musculus OX=10090 GN=Bmpr2 PE=1 SV=1
10	AFDB:A0A499FIJ6	0.054	0.051	1.147E-2	1031	0.154	0.142	A0A499FIJ6.pdb.gz	A0A499FIJ6_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=2
11	AFDB:Q9QX75	0.046	0.061	1.147E-2	687	0.101	0.140	Q9QX75.pdb.gz	TRDN_RAT Triadin OS=Rattus norvegicus OX=10116 GN=Trdn PE=1 SV=1
12	PDB:6ah0u	0.059	0.367	1.557E-1	124	0.024	0.185	6ah0u.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
13	PDB:5nrlV	0.064	0.420	1.435	127	0.009	0.071	5nrlV.pdb.gz	Structure of a pre-catalytic spliceosome.
14	PDB:6qw65B	0.041	0.024	1.521	2001	0.036	0.017	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:4ob3B	0.045	0.135	1.710	229	0.021	0.087	4ob3B.pdb.gz	The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
16	PDB:5mrc66	0.039	0.075	3.253	305	0.029	0.092	5mrc66.pdb.gz	The structure of the yeast mitochondrial ribosome.
17	PDB:5apnh	0.046	0.200	4.109	119	0.017	0.134	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:1b71A	0.042	0.138	4.356	191	0.016	0.079	1b71A.pdb.gz	Alternative metal-binding sites in rubrerythrin.
19	PDB:2kg7B	0.039	0.256	4.619	97	0.007	0.072	2kg7B.pdb.gz
20	PDB:6dv9F	0.037	0.112	4.897	174	0.019	0.103	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZTQ1	0.0	1362	945	0.886	0.892	SFSWA_RAT Splicing factor, suppressor of white-apricot homolog OS=Rattus norvegicus OX=10116 GN=Sfswap PE=1 SV=1
2	Q12872	0.0	1933	951	1.000	1.000	SFSWA_HUMAN Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3
3	Q3USH5	0.0	1362	945	0.885	0.891	SFSWA_MOUSE Splicing factor, suppressor of white-apricot homolog OS=Mus musculus OX=10090 GN=Sfswap PE=1 SV=2
4	Q15459	9.81e-09	61.6	793	0.041	0.049	SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1
5	Q8N2M8	6.68e-07	55.8	674	0.034	0.047	CLASR_HUMAN CLK4-associating serine/arginine rich protein OS=Homo sapiens OX=9606 GN=CLASRP PE=1 SV=4
6	A0A0A0MQS2	7.15e-07	55.5	674	0.034	0.047	A0A0A0MQS2_HUMAN CLK4 associating serine/arginine rich protein OS=Homo sapiens OX=9606 GN=CLASRP PE=1 SV=1
7	F5H0Q6	8.58e-07	55.5	655	0.034	0.049	F5H0Q6_HUMAN CLK4 associating serine/arginine rich protein OS=Homo sapiens OX=9606 GN=CLASRP PE=1 SV=2
8	G5ECL3	5.35e-06	52.8	655	0.027	0.040	G5ECL3_CAEEL Pre-RNA processing 21 OS=Caenorhabditis elegans OX=6239 GN=prp-21 PE=1 SV=1
9	O13900	2.15e-05	50.4	481	0.028	0.056	SA114_SCHPO Pre-mRNA-splicing factor sap114 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sap114 PE=1 SV=1
10	Q9VEP9	1.84e-04	47.8	784	0.022	0.027	Q9VEP9_DROME GH03554p OS=Drosophila melanogaster OX=7227 GN=Sf3a1 PE=1 SV=1
11	O15042	0.022	41.2	1029	0.040	0.037	SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=2
12	E7ET15	0.043	40.0	1028	0.037	0.034	E7ET15_HUMAN U2 snRNP associated SURP domain containing OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=1
13	Q8CGZ0	0.047	40.0	936	0.023	0.024	CHERP_MOUSE Calcium homeostasis endoplasmic reticulum protein OS=Mus musculus OX=10090 GN=Cherp PE=1 SV=1
14	D3ZAX5	0.049	40.0	946	0.023	0.023	D3ZAX5_RAT Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3
15	Q8IWX8	0.054	39.7	916	0.023	0.024	CHERP_HUMAN Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3
16	G5E870	0.49	37.0	2025	0.049	0.023	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
17	Q61136	0.71	36.2	1007	0.061	0.058	PRP4B_MOUSE Serine/threonine-protein kinase PRP4 homolog OS=Mus musculus OX=10090 GN=Prpf4b PE=1 SV=3
18	Q7K0L8	1.7	35.0	844	0.050	0.057	Q7K0L8_DROME FLICE-associated huge protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FLASH PE=1 SV=1
19	Q8SZS8	5.1	33.5	699	0.050	0.069	Q8SZS8_DROME LD12230p (Fragment) OS=Drosophila melanogaster OX=7227 GN=FLASH PE=2 SV=2
20	A0A8I3NPD4	6.2	33.1	1398	0.046	0.031	A0A8I3NPD4_CANLF Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Canis lupus familiaris OX=9615 GN=MAGI1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09750 DRY_EERY	2.7e-30	116.8	Alternative splicing regulator
2	PF01805 Surp	8.2e-24	94.7	Surp module

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437738

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362110	0.887	Splicing factor 3A subunit 3
2	9606.ENSP00000221494	0.821	Splicing factor 3A subunit 2
3	9606.ENSP00000418563	0.747	U2 snRNP-associated SURP motif-containing protein
4	9606.ENSP00000472286	0.741	SURP and G-patch domain-containing protein 2
5	9606.ENSP00000377969	0.740	General transcription factor IIF subunit 1
6	9606.ENSP00000439856	0.729	Calcium homeostasis endoplasmic reticulum protein
7	9606.ENSP00000334538	0.700	Splicing regulatory glutamine/lysine-rich protein 1
8	9606.ENSP00000359988	0.664	Serine/arginine-rich splicing factor 11
9	9606.ENSP00000380559	0.657	Crm, cramped-like (Drosophila)
10	9606.ENSP00000359958	0.654	Zinc finger Ran-binding domain-containing protein 2
11	9606.ENSP00000438993	0.638	Zinc finger CCHC domain-containing protein 8
12	9606.ENSP00000484532	0.631	Protein MIS12 homolog
13	9606.ENSP00000216277	0.596	Poly(A) polymerase alpha
14	9606.ENSP00000472998	0.582	U1 small nuclear ribonucleoprotein 70 kDa
15	9606.ENSP00000267260	0.581	Serine/arginine repetitive matrix protein 4
16	9606.ENSP00000326261	0.574	Serine/arginine repetitive matrix protein 1
17	9606.ENSP00000362820	0.570	Serine/arginine-rich splicing factor 3
18	9606.ENSP00000257787	0.568	Akirin-2
19	9606.ENSP00000416959	0.560	Transformer-2 protein homolog beta
20	9606.ENSP00000325905	0.547	Serine/arginine-rich splicing factor 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.436	organic cyclic compound binding
GO:0003676	0.421	nucleic acid binding
GO:0003723	0.402	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006396	0.990	RNA processing
GO:0000398	0.982	mRNA splicing, via spliceosome
GO:0050789	0.972	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0071826	0.955	ribonucleoprotein complex subunit organization
GO:0022613	0.947	ribonucleoprotein complex biogenesis
GO:0051252	0.941	regulation of RNA metabolic process
GO:0000245	0.941	spliceosomal complex assembly
GO:0010468	0.935	regulation of gene expression
GO:0043484	0.928	regulation of RNA splicing
GO:0006376	0.923	mRNA splice site selection
GO:0050684	0.907	regulation of mRNA processing
GO:0048519	0.897	negative regulation of biological process
GO:0048523	0.825	negative regulation of cellular process
GO:0048024	0.765	regulation of mRNA splicing, via spliceosome
GO:0010605	0.682	negative regulation of macromolecule metabolic process
GO:0031324	0.586	negative regulation of cellular metabolic process
GO:0051172	0.585	negative regulation of nitrogen compound metabolic process
GO:0000380	0.514	alternative mRNA splicing, via spliceosome
GO:0045934	0.492	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.479	negative regulation of RNA metabolic process
GO:0010629	0.417	negative regulation of gene expression
GO:0045292	0.365	mRNA cis splicing, via spliceosome
GO:1903312	0.361	negative regulation of mRNA metabolic process
GO:0033119	0.350	negative regulation of RNA splicing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016607	0.991	nuclear speck
GO:0032991	0.325	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]