StarFunc result for job id Q12873

User Input

>input (2000 residues)
MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKEN
KPGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKK
GEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKI
PMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPP
ALPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPLKIKLGLLG
GKRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPGRKKKKVL
GCPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSC
PHCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACISSYHI
HCLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDVPPPR
PLQGRSEREFFVKWVGLSYWHCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYGSGED
DGKSDKRKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINHSVDKKGNYHYLVKWRDLPYDQ
STWEEDEMNIPEYEEHKQSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPSSPTNDPTV
KYETQPRFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLYK
EGHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDNAIKG
GKKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFFRVLN
GYKIDHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLL
GPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQVSLLN
IMMDLKKCCNHPYLFPVAAMESPKLPSGAYEGGALIKSSGKLMLLQKMLRKLKEQGHRVL
IFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFLLSTRAGG
LGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKR
KMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAI
ARLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENVDPDYWEK
LLRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDEDFDERPEG
RRQSKRQLRNEKDKPLPPLLARVGGNIEVLGFNTRQRKAFLNAVMRWGMPPQDAFTTQWL
VRDLRGKTEKEFKAYVSLFMRHLCEPGADGSETFADGVPREGLSRQQVLTRIGVMSLVKK
KVQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPTTPEASATNSPCTSKPATPAP
SEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDE
VPGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDGQEHRERPEGETGDLGKREDVKG
DRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIW
HRRHDYWLLAGIVLHGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLARRFKLL
EQALVIEEQLRRAAYLNLSQEPAHPAMALHARFAEAECLAESHQHLSKESLAGNKPANAV
LHKVLNQLEELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAY
PPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGAL
VSDGLDRKEPRAGEVICIDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IJ89	0.581	0.585	0.000	1980	0.672	0.679	A0A0R4IJ89.pdb.gz
2	AFDB:A0A2R8Q3B4	0.538	0.581	0.000	1820	0.723	0.795	A0A2R8Q3B4.pdb.gz
3	AFDB:E9PU01	0.536	0.553	0.000	1921	0.663	0.690	E9PU01.pdb.gz	E9PU01_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=4
4	AFDB:F1QWV5	0.517	0.529	0.000	1952	0.645	0.661	F1QWV5.pdb.gz
5	AFDB:O97159	0.480	0.483	0.000	1982	0.531	0.536	O97159.pdb.gz	CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster OX=7227 GN=Mi-2 PE=1 SV=2
6	AFDB:Q8TDI0	0.427	0.437	0.000	1954	0.674	0.690	Q8TDI0.pdb.gz	CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens OX=9606 GN=CHD5 PE=1 SV=1
7	AFDB:P40201	0.318	0.368	8.918E-72	1711	0.223	0.260	P40201.pdb.gz	CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus OX=10090 GN=Chd1 PE=1 SV=3
8	AFDB:Q54Q16	0.306	0.319	9.292E-69	1917	0.236	0.246	Q54Q16.pdb.gz	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
9	AFDB:A0A1D8PJG4	0.244	0.368	5.532E-48	1302	0.129	0.197	A0A1D8PJG4.pdb.gz	A0A1D8PJG4_CANAL RSC chromatin remodeling complex ATPase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STH1 PE=4 SV=1
10	AFDB:Q7ZSY3	0.239	0.291	7.313E-46	1627	0.176	0.216	Q7ZSY3.pdb.gz	Q7ZSY3_DANRE Brahma protein-like protein 1 OS=Danio rerio OX=7955 GN=smarca4 PE=1 SV=1
11	PDB:6g0lM	0.261	0.592	1.036E-44	855	0.137	0.320	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
12	PDB:6g0lW	0.267	0.593	1.630E-44	878	0.143	0.327	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
13	PDB:6jylK	0.221	0.859	5.556E-39	504	0.108	0.431	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
14	PDB:6tdaS	0.220	0.552	2.720E-36	783	0.106	0.272	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
15	PDB:7epuB	0.164	0.356	1.313E-34	748	0.110	0.294	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
16	PDB:6uxwA	0.227	0.558	1.801E-33	778	0.117	0.299	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
17	PDB:6kw3Y	0.223	0.769	8.697E-32	548	0.107	0.391	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
18	PDB:7oo3b	0.207	0.726	9.618E-32	534	0.084	0.313	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
19	PDB:6gejM	0.211	0.596	4.357E-31	688	0.105	0.307	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
20	PDB:5vvrM	0.196	0.700	3.324E-25	503	0.079	0.314	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGG9	2446	1937	0.646	0.668	A0A0C4DGG9_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
2	A0A2R8Y212	2459	1914	0.646	0.676	A0A2R8Y212_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
3	A0A2R8Y425	2454	1889	0.646	0.684	A0A2R8Y425_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
4	A0A2R8Y521	2429	1920	0.642	0.669	A0A2R8Y521_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
5	A0A2R8Y5J0	2440	1892	0.642	0.679	A0A2R8Y5J0_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
6	A0A2R8Y8C1	2087	1669	0.547	0.656	A0A2R8Y8C1_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
7	A0A2R8YFD8	2462	1903	0.645	0.678	A0A2R8YFD8_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
8	A0A2R8YFK9	2440	1899	0.642	0.677	A0A2R8YFK9_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
9	A0A2U3TZM0	2433	1902	0.642	0.675	A0A2U3TZM0_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
10	A2A8L1	2560	1946	0.660	0.679	CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus OX=10090 GN=Chd5 PE=1 SV=1
11	B1AR17	3959	2055	0.961	0.935	B1AR17_MOUSE DNA helicase OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
12	D3ZD32	2570	1948	0.669	0.687	CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Chd5 PE=1 SV=1
13	E9PU01	2102	1928	0.541	0.561	E9PU01_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=4
14	E9Q614	3885	2021	0.946	0.936	E9Q614_MOUSE DNA helicase OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
15	F5GWX5	2461	1905	0.646	0.679	F5GWX5_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
16	F7C528	3795	1886	0.921	0.977	F7C528_MOUSE DNA helicase (Fragment) OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
17	G5EBZ4	1408	1829	0.377	0.412	LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans OX=6239 GN=let-418 PE=1 SV=1
18	O16102	1003	892	0.252	0.565	CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster OX=7227 GN=Chd3 PE=1 SV=3
19	O97159	1547	1982	0.419	0.423	CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster OX=7227 GN=Mi-2 PE=1 SV=2
20	Q12873	4142	2000	1.000	1.000	CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	2.8e+02	13.2	AAA domain
2	PF08074 CHDCT2	1.8e-73	256.9	CHDCT2 (NUC038) domain
3	PF06461 CHDII_SANT-like	3.8e-59	209.9	CHD subfamily II, SANT-like domain
4	PF08073 CHDNT	6.7e-23	91.6	CHDNT (NUC034) domain
5	PF00385 Chromo	2.6e-16	70.6	Chromo (CHRromatin Organisation MOdifier) domain
6	PF00270 DEAD	21	16.4	DEAD/DEAH box helicase
7	PF06465 DUF1087	6.8e-21	85.4	CHD subfamily II, DUF1087
8	PF11496 HDA2-3	0.00064	30.6	Class II histone deacetylase complex subunits 2 and 3
9	PF00271 Helicase_C	6.2e-18	76.5	Helicase conserved C-terminal domain
10	PF00505 HMG_box	10	17.9	HMG (high mobility group) box
11	PF00628 PHD	4e-17	73.1	PHD-finger
12	PF13831 PHD_2	88	14.0	PHD-finger
13	PF04851 ResIII	4.1e-05	35.2	Type III restriction enzyme, res subunit
14	PF00176 SNF2-rel_dom	2.4e-61	219.0	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003929245.1

Rank	PPI partner	STRING score	Description
1	27679.XP_010346435.1	0.982	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
2	27679.XP_003942359.1	0.980	Transcriptional repressor p66-alpha isoform X1
3	27679.XP_003924187.1	0.971	LOW QUALITY PROTEIN: histone-binding protein RBBP7
4	27679.XP_003920277.1	0.970	Metastasis-associated protein MTA2
5	27679.XP_003941922.1	0.967	Transcriptional repressor p66-beta isoform X1
6	27679.XP_010331393.1	0.965	Histone deacetylase 2-like
7	27679.XP_010347624.1	0.965	Histone deacetylase 2
8	27679.XP_010342187.1	0.964	Metastasis-associated protein MTA1 isoform X1
9	27679.XP_010343768.1	0.945	Lysine-specific histone demethylase 1A isoform X1
10	27679.XP_010328349.1	0.938	chromodomain-helicase-DNA-binding protein 4
11	27679.XP_010334387.1	0.933	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
12	27679.XP_010346505.1	0.933	Histone-binding protein RBBP4
13	27679.XP_010347679.1	0.933	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
14	27679.XP_010335774.1	0.932	Metastasis-associated protein MTA3 isoform X1
15	27679.XP_010330757.1	0.926	methyl-CpG-binding domain protein 3
16	27679.XP_003926168.2	0.918	methyl-CpG-binding domain protein 2
17	27679.XP_010328620.1	0.911	Nucleosome-remodeling factor subunit BPTF isoform X1
18	27679.XP_010330677.1	0.858	Transcription intermediary factor 1-beta
19	27679.XP_010336179.1	0.853	Transcription factor SOX-2
20	27679.XP_003931243.1	0.851	methyl-CpG-binding domain protein 3-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.942	heterocyclic compound binding
GO:0097159	0.939	organic cyclic compound binding
GO:0003676	0.934	nucleic acid binding
GO:0003677	0.894	DNA binding
GO:0003824	0.865	catalytic activity
GO:0017111	0.829	ribonucleoside triphosphate phosphatase activity
GO:0003682	0.794	chromatin binding
GO:0016887	0.790	ATP hydrolysis activity
GO:0008094	0.715	ATP-dependent activity, acting on DNA
GO:0140658	0.713	ATP-dependent chromatin remodeler activity
GO:0008134	0.346	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0016043	0.992	cellular component organization
GO:0006325	0.979	chromatin organization
GO:0050789	0.616	regulation of biological process
GO:0050794	0.604	regulation of cellular process
GO:0008152	0.535	metabolic process
GO:0019222	0.501	regulation of metabolic process
GO:0060255	0.492	regulation of macromolecule metabolic process
GO:0071704	0.475	organic substance metabolic process
GO:0044238	0.441	primary metabolic process
GO:0043170	0.437	macromolecule metabolic process
GO:0080090	0.435	regulation of primary metabolic process
GO:0051171	0.432	regulation of nitrogen compound metabolic process
GO:0031323	0.431	regulation of cellular metabolic process
GO:0006807	0.414	nitrogen compound metabolic process
GO:0010468	0.393	regulation of gene expression
GO:0019219	0.392	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.325	negative regulation of biological process
GO:0010556	0.308	regulation of macromolecule biosynthetic process
GO:0031326	0.308	regulation of cellular biosynthetic process
GO:0051252	0.306	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.999	nuclear protein-containing complex
GO:1902494	0.998	catalytic complex
GO:0000785	0.998	chromatin
GO:0090545	0.966	CHD-type complex
GO:0016581	0.956	NuRD complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.829	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.829	nucleoside-triphosphate phosphatase.
RHEA:13065	0.790	ATP + H2O = ADP + H(+) + phosphate

[back to server]