StarFunc result for job id Q12882

User Input

>input (1025 residues)
MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFD
DIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDN
PLGLTCGMVCPTSDLCVGGCNLYATEEGPINIGGLQQFATEVFKAMSIPQIRNPSLPPPE
KMSEAYSAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGLSTSEIPQFRLPYDV
VNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAFIGIGLPEPNKDAIFQGLTQD
QGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATSALRCGARRVF
IVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKGGRIVAMQFVRTEQDETGKWN
EDEDQMVHLKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPETMQTSEAWVFAGG
DVVGLANTTVESVNDGKQASWYIHKYVQSQYGASVSAKPELPLFYTPIDLVDISVEMAGL
KFINPFGLASATPATSTSMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMY
GPGQSSFLNIELISEKTAAYWCQSVTELKADFPDNIVIASIMCSYNKNDWTELAKKSEDS
GADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVQIPFFAKLTPNVTDIVSI
ARAAKEGGANGVTATNTVSGLMGLKSDGTPWPAVGIAKRTTYGGVSGTAIRPIALRAVTS
IARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYL
KSIEELQDWDGQSPATVSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQ
NVAFSPLKRNCFIPKRPIPTIKDVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCY
MTCNDSGYQAIQFDPETHLPTITDTCTGCTLCLSVCPIVDCIKMVSRTTPYEPKRGVPLS
VNPVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1gthA	0.993	0.999	0.000	1019	0.922	0.927	1gthA.pdb.gz	Crystal structure of the productive ternary complex of dihydropyrimidine dehydrogenase with NADPH and 5-iodouracil. Implications for mechanism of inhibition and electron transfer.
2	AFDB:O89000	0.999	0.999	0.000	1025	0.891	0.891	O89000.pdb.gz	DPYD_RAT Dihydropyrimidine dehydrogenase [NADP(+)] OS=Rattus norvegicus OX=10116 GN=Dpyd PE=2 SV=1
3	AFDB:Q12882	1.000	1.000	0.000	1025	1.000	1.000	Q12882.pdb.gz	DPYD_HUMAN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Homo sapiens OX=9606 GN=DPYD PE=1 SV=2
4	AFDB:Q4TWT4	0.966	0.961	0.000	1031	0.655	0.651	Q4TWT4.pdb.gz	Q4TWT4_DROME Dihydropyrimidine dehydrogenase [NADP(+)] OS=Drosophila melanogaster OX=7227 GN=su(r) PE=3 SV=1
5	AFDB:P25889	0.365	0.892	2.643E-37	411	0.142	0.355	P25889.pdb.gz	PREA_ECOLI NAD-dependent dihydropyrimidine dehydrogenase subunit PreA OS=Escherichia coli (strain K12) OX=83333 GN=preA PE=1 SV=3
6	AFDB:P09832	0.388	0.815	5.844E-34	472	0.129	0.280	P09832.pdb.gz	GLTD_ECOLI Glutamate synthase [NADPH] small chain OS=Escherichia coli (strain K12) OX=83333 GN=gltD PE=1 SV=3
7	AFDB:Q9LVI9	0.303	0.719	4.638E-33	426	0.129	0.310	Q9LVI9.pdb.gz	DPYD_ARATH Dihydropyrimidine dehydrogenase (NADP(+)), chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PYD1 PE=1 SV=1
8	AFDB:P76440	0.378	0.911	1.573E-32	412	0.128	0.318	P76440.pdb.gz	PRET_ECOLI NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Escherichia coli (strain K12) OX=83333 GN=preT PE=1 SV=1
9	AFDB:Q46811	0.351	0.349	5.405E-27	1032	0.120	0.119	Q46811.pdb.gz	YGFK_ECOLI Putative oxidoreductase YgfK OS=Escherichia coli (strain K12) OX=83333 GN=ygfK PE=1 SV=1
10	AFDB:Q74FU5	0.358	0.538	8.112E-26	672	0.112	0.171	Q74FU5.pdb.gz	SFRB_GEOSL NADPH-Fe(3+) oxidoreductase subunit beta OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=sfrB PE=1 SV=1
11	AFDB:Q9C102	0.390	0.196	4.209E-25	2111	0.112	0.054	Q9C102.pdb.gz	GLT1_SCHPO Glutamate synthase [NADH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=glt1 PE=1 SV=1
12	PDB:1ep3A	0.264	0.832	2.944E-19	311	0.082	0.270	1ep3A.pdb.gz	Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster.
13	PDB:6et4A	0.256	0.685	2.503E-16	367	0.063	0.177	6et4A.pdb.gz	A DHODH inhibitor increases p53 synthesis and enhances tumor cell killing by p53 degradation blockage.
14	PDB:3itjB	0.185	0.499	2.639E-16	319	0.068	0.219	3itjB.pdb.gz	Insights into the specificity of thioredoxin reductase-thioredoxin interactions. A structural and functional investigation of the yeast thioredoxin system.
15	PDB:5xfwD	0.263	0.807	7.240E-16	315	0.070	0.229	5xfwD.pdb.gz
16	PDB:4ef8B	0.259	0.792	1.883E-15	314	0.066	0.217	4ef8B.pdb.gz	Target sites for the design of anti-trypanosomatid drugs based on the structure of dihydroorotate dehydrogenase.
17	PDB:4oriA	0.251	0.694	2.209E-15	355	0.063	0.183	4oriA.pdb.gz	Fluorine Modulates Species Selectivity in the Triazolopyrimidine Class of Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors.
18	PDB:1f76A	0.242	0.705	1.576E-14	336	0.064	0.196	1f76A.pdb.gz	E. coli Dihydroorotate Dehydrogenase Reveals Structural and Functional Distinction between different classes of dihydroorotate dehydrogenases
19	PDB:1f6mA	0.241	0.702	3.496E-14	320	0.060	0.191	1f6mA.pdb.gz	Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
20	PDB:2a87A	0.184	0.501	4.560E-14	313	0.066	0.217	2a87A.pdb.gz	Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O89000	0.0	1909	1025	0.892	0.892	DPYD_RAT Dihydropyrimidine dehydrogenase [NADP(+)] OS=Rattus norvegicus OX=10116 GN=Dpyd PE=2 SV=1
2	Q12882	0.0	2121	1025	1.000	1.000	DPYD_HUMAN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Homo sapiens OX=9606 GN=DPYD PE=1 SV=2
3	Q28007	0.0	1972	1025	0.923	0.923	DPYD_BOVIN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Bos taurus OX=9913 GN=DPYD PE=1 SV=1
4	Q28943	0.0	1986	1025	0.927	0.927	DPYD_PIG Dihydropyrimidine dehydrogenase [NADP(+)] OS=Sus scrofa OX=9823 GN=DPYD PE=1 SV=1
5	Q4TWT4	0.0	1352	1031	0.657	0.653	Q4TWT4_DROME Dihydropyrimidine dehydrogenase [NADP(+)] OS=Drosophila melanogaster OX=7227 GN=su(r) PE=3 SV=1
6	Q8CHR6	0.0	1925	1025	0.896	0.896	DPYD_MOUSE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Mus musculus OX=10090 GN=Dpyd PE=1 SV=1
7	Q94914	0.0	755	626	0.376	0.615	Q94914_DROME Dihydropyrimidine dehydrogenase [NADP(+)] OS=Drosophila melanogaster OX=7227 GN=su(r) PE=2 SV=1
8	Q95U76	0.0	1098	864	0.533	0.632	Q95U76_DROME Dihydropyrimidine dehydrogenase [NADP(+)] OS=Drosophila melanogaster OX=7227 GN=su(r) PE=2 SV=1
9	Q9W374	0.0	1355	1031	0.658	0.654	Q9W374_DROME Dihydropyrimidine dehydrogenase [NADP(+)] OS=Drosophila melanogaster OX=7227 GN=su(r) PE=1 SV=2
10	Q9LVI9	1.88e-64	226	426	0.118	0.284	DPYD_ARATH Dihydropyrimidine dehydrogenase (NADP(+)), chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PYD1 PE=1 SV=1
11	P25889	4.60e-54	196	411	0.115	0.287	PREA_ECOLI NAD-dependent dihydropyrimidine dehydrogenase subunit PreA OS=Escherichia coli (strain K12) OX=83333 GN=preA PE=1 SV=3
12	P76440	3.81e-49	182	412	0.137	0.340	PRET_ECOLI NAD-dependent dihydropyrimidine dehydrogenase subunit PreT OS=Escherichia coli (strain K12) OX=83333 GN=preT PE=1 SV=1
13	P09832	1.01e-41	162	472	0.132	0.286	GLTD_ECOLI Glutamate synthase [NADPH] small chain OS=Escherichia coli (strain K12) OX=83333 GN=gltD PE=1 SV=3
14	Q46811	8.42e-28	124	1032	0.119	0.118	YGFK_ECOLI Putative oxidoreductase YgfK OS=Escherichia coli (strain K12) OX=83333 GN=ygfK PE=1 SV=1
15	P54322	8.23e-27	114	311	0.089	0.293	PYRDB_LACLM Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=pyrDB PE=1 SV=2
16	Q74FU5	2.84e-23	108	672	0.117	0.179	SFRB_GEOSL NADPH-Fe(3+) oxidoreductase subunit beta OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=sfrB PE=1 SV=1
17	Q725V9	2.13e-20	95.5	307	0.069	0.231	Q725V9_DESVH Dihydroorotate dehydrogenase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=pyrD PE=1 SV=1
18	Q9C102	7.71e-18	92.0	2111	0.118	0.057	GLT1_SCHPO Glutamate synthase [NADH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=glt1 PE=1 SV=1
19	C8VEZ6	1.42e-17	91.3	2126	0.116	0.056	C8VEZ6_EMENI glutamate synthase (NADH) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05134 PE=3 SV=1
20	Q9LV03	3.80e-17	89.7	2208	0.107	0.050	GLUT1_ARATH Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01180 DHO_dh	2.9e-32	123.7	Dihydroorotate dehydrogenase
2	PF01207 Dus	0.00051	30.8	Dihydrouridine synthase (Dus)
3	PF12831 FAD_oxidored	7.8e+02	10.7	FAD dependent oxidoreductase
4	PF00037 Fer4	32	15.7	4Fe-4S binding domain
5	PF13237 Fer4_10	0.61	21.5	4Fe-4S dicluster domain
6	PF12797 Fer4_2	3.7	18.9	4Fe-4S binding domain
7	PF14691 Fer4_20	2.4e-28	109.5	Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster
8	PF14697 Fer4_21	1.4e-19	81.3	4Fe-4S dicluster domain
9	PF12837 Fer4_6	11	17.5	4Fe-4S binding domain
10	PF12838 Fer4_7	0.76	21.7	4Fe-4S dicluster domain
11	PF13183 Fer4_8	1.3e+02	14.4	4Fe-4S dicluster domain
12	PF13187 Fer4_9	36	15.9	4Fe-4S dicluster domain
13	PF18725 HEPN_SAV2148	6.2e+02	11.2	SAV2148-like HEPN
14	PF13450 NAD_binding_8	0.00064	31.2	NAD(P)-binding Rossmann-like domain
15	PF00070 Pyr_redox	0.26	23.1	Pyridine nucleotide-disulphide oxidoreductase
16	PF07992 Pyr_redox_2	5.7e-10	50.5	Pyridine nucleotide-disulphide oxidoreductase
17	PF13738 Pyr_redox_3	0.083	23.7	Pyridine nucleotide-disulphide oxidoreductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359211

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232607	0.986	Uridine 5'-monophosphate synthase
2	9606.ENSP00000324343	0.986	Beta-ureidopropionase
3	9606.ENSP00000276651	0.985	Dihydropyrimidinase
4	9606.ENSP00000379038	0.982	Thymidine phosphorylase
5	9606.ENSP00000330032	0.978	Uridine phosphorylase 1
6	9606.ENSP00000474090	0.963	Uridine phosphorylase 2
7	9606.ENSP00000354532	0.957	Purine nucleoside phosphorylase
8	9606.ENSP00000362481	0.952	Uracil phosphoribosyltransferase homolog
9	9606.ENSP00000301141	0.946	Cytochrome P450 2A6
10	9606.ENSP00000315644	0.891	Thymidylate synthase
11	9606.ENSP00000420914	0.812	Peroxisomal multifunctional enzyme type 2
12	9606.ENSP00000371253	0.808	Trifunctional purine biosynthetic protein adenosine-3
13	9606.ENSP00000264220	0.778	Amidophosphoribosyltransferase
14	9606.ENSP00000257915	0.772	Alpha-globin transcription factor CP2
15	9606.ENSP00000289004	0.772	4-hydroxyphenylpyruvate dioxygenase
16	9606.ENSP00000343690	0.755	Dihydropyrimidinase-related protein 3
17	9606.ENSP00000357535	0.742	Enoyl-CoA hydratase, mitochondrial
18	9606.ENSP00000312304	0.740	Thiopurine S-methyltransferase
19	9606.ENSP00000338235	0.739	Protein LYRIC
20	9606.ENSP00000416515	0.733	NADPH:adrenodoxin oxidoreductase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	0.998	protein homodimerization activity
GO:0017113	0.998	dihydropyrimidine dehydrogenase (NADP+) activity
GO:0050661	0.985	NADP binding
GO:0043167	0.914	ion binding
GO:0043168	0.799	anion binding
GO:0050660	0.783	flavin adenine dinucleotide binding
GO:0010181	0.392	FMN binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:1901360	0.988	organic cyclic compound metabolic process
GO:0044281	0.980	small molecule metabolic process
GO:0046483	0.979	heterocycle metabolic process
GO:0044248	0.977	cellular catabolic process
GO:0046113	0.974	nucleobase catabolic process
GO:0072529	0.956	pyrimidine-containing compound catabolic process
GO:0006206	0.861	pyrimidine nucleobase metabolic process
GO:1901135	0.793	carbohydrate derivative metabolic process
GO:1901136	0.400	carbohydrate derivative catabolic process
GO:0019439	0.396	aromatic compound catabolic process
GO:0050896	0.386	response to stimulus
GO:0034655	0.325	nucleobase-containing compound catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.335	membrane-bounded organelle
GO:0043231	0.310	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18093	0.998	5,6-dihydrouracil + NADP(+) = H(+) + NADPH + uracil
EC:1.3.1.2	0.998	dihydropyrimidine dehydrogenase (NADP(+)).

[back to server]