StarFunc result for job id Q12887

User Input

>input (443 residues)
MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMY
VTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIE
LEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLSKIKLTALVVSTTAAGFALA
PGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFA
TCCAVPGVAILTLGVNPLTGALGLFNIFLYTCCYTPLKRISIANTWVGAVVGAIPPVMGW
TAATGSLDAGAFLLGGILYSWQFPHFNALSWGLREDYSRGGYCMMSVTHPGLCRRVALRH
CLALLVLSAAAPVLDITTWTFPIMALPINAYISYLGFRFYVDADRRSSRRLFFCSLWHLP
LLLLLMLTCKRPSGGGDAGPPPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12887	1.000	1.000	6.585E-57	443	1.000	1.000	Q12887.pdb.gz	COX10_HUMAN Protoheme IX farnesyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COX10 PE=1 SV=3
2	AFDB:Q8CFY5	0.722	0.722	7.266E-44	443	0.819	0.819	Q8CFY5.pdb.gz	COX10_MOUSE Protoheme IX farnesyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Cox10 PE=2 SV=1
3	AFDB:P21592	0.633	0.608	1.756E-20	462	0.296	0.284	P21592.pdb.gz	COX10_YEAST Protoheme IX farnesyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX10 PE=3 SV=1
4	AFDB:Q9Y7Y4	0.616	0.703	1.582E-19	387	0.293	0.336	Q9Y7Y4.pdb.gz	COX10_SCHPO Protoheme IX farnesyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox10 PE=3 SV=1
5	AFDB:P0AEA5	0.608	0.900	5.601E-16	296	0.183	0.274	P0AEA5.pdb.gz	CYOE_ECOLI Protoheme IX farnesyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=cyoE PE=1 SV=1
6	AFDB:Q9I423	0.611	0.905	4.456E-15	296	0.176	0.264	Q9I423.pdb.gz	CYOE2_PSEAE Protoheme IX farnesyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cyoE2 PE=3 SV=1
7	AFDB:O31652	0.578	0.787	2.652E-14	320	0.181	0.250	O31652.pdb.gz	COXX1_BACSU Protoheme IX farnesyltransferase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=ctaB1 PE=1 SV=3
8	AFDB:P9WFR7	0.595	0.841	1.679E-12	308	0.165	0.237	P9WFR7.pdb.gz	COXX_MYCTU Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ctaB PE=3 SV=1
9	AFDB:Q66JT7	0.551	0.645	5.948E-11	374	0.147	0.174	Q66JT7.pdb.gz	COQ2_MOUSE 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Coq2 PE=1 SV=2
10	AFDB:C6KSS3	0.518	0.447	2.243E-10	521	0.147	0.125	C6KSS3.pdb.gz	C6KSS3_PLAF7 4-hydroxybenzoate polyprenyltransferase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0607500 PE=3 SV=1
11	PDB:1rqiA	0.300	0.404	1.861E-2	300	0.072	0.107	1rqiA.pdb.gz	Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
12	PDB:3aqbD	0.331	0.429	3.766E-2	325	0.090	0.123	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
13	PDB:3ucaA	0.293	0.424	4.446E-2	274	0.050	0.080	3ucaA.pdb.gz
14	PDB:3lvsB	0.262	0.375	1.420E-1	274	0.090	0.146	3lvsB.pdb.gz
15	PDB:1wmwA	0.283	0.357	1.822E-1	328	0.093	0.125	1wmwA.pdb.gz
16	PDB:3ipiA	0.316	0.475	2.242E-1	268	0.077	0.127	3ipiA.pdb.gz
17	PDB:3lomA	0.265	0.359	2.646E-1	288	0.061	0.094	3lomA.pdb.gz
18	PDB:4gp2A	0.306	0.377	3.538E-1	342	0.097	0.126	4gp2A.pdb.gz	Crystal Structure of Isoprenoid Synthase from Pyrobaculum Calidifontis
19	PDB:6c56B	0.321	0.480	3.538E-1	267	0.070	0.116	6c56B.pdb.gz	Unraveling the Prenylation-Cancer Paradox in Multiple Myeloma with Novel Geranylgeranyl Pyrophosphate Synthase (GGPPS) Inhibitors.
20	PDB:3ts7B	0.281	0.376	3.687E-1	297	0.093	0.138	3ts7B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12887	0.0	910	443	1.000	1.000	COX10_HUMAN Protoheme IX farnesyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COX10 PE=1 SV=3
2	Q8CFY5	0.0	721	443	0.822	0.822	COX10_MOUSE Protoheme IX farnesyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Cox10 PE=2 SV=1
3	H7C101	9.23e-118	343	171	0.375	0.971	H7C101_HUMAN Cytochrome c oxidase assembly factor heme A:farnesyltransferase COX10 OS=Homo sapiens OX=9606 GN=COX10 PE=1 SV=2
4	P21592	1.88e-60	206	462	0.334	0.320	COX10_YEAST Protoheme IX farnesyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX10 PE=3 SV=1
5	Q9Y7Y4	9.65e-58	196	387	0.257	0.295	COX10_SCHPO Protoheme IX farnesyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox10 PE=3 SV=1
6	P0AEA5	4.58e-29	117	296	0.185	0.277	CYOE_ECOLI Protoheme IX farnesyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=cyoE PE=1 SV=1
7	O31652	1.98e-24	105	320	0.167	0.231	COXX1_BACSU Protoheme IX farnesyltransferase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=ctaB1 PE=1 SV=3
8	Q9I423	9.58e-20	91.3	296	0.176	0.264	CYOE2_PSEAE Protoheme IX farnesyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cyoE2 PE=3 SV=1
9	P9WFR7	1.55e-14	76.3	308	0.153	0.221	COXX_MYCTU Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ctaB PE=3 SV=1
10	Q10252	1.69e-06	52.4	360	0.104	0.128	COQ2_SCHPO 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppt1 PE=1 SV=2
11	Q96H96	3.81e-06	51.2	371	0.120	0.143	COQ2_HUMAN 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ2 PE=1 SV=2
12	Q66JT7	4.23e-06	50.8	374	0.104	0.123	COQ2_MOUSE 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Coq2 PE=1 SV=2
13	Q8W405	8.45e-04	43.5	307	0.074	0.107	PGT1_LITER 4-hydroxybenzoate geranyltransferase 1 OS=Lithospermum erythrorhizon OX=34254 GN=PGT-1 PE=1 SV=1
14	C6KSS3	0.001	43.9	521	0.077	0.065	C6KSS3_PLAF7 4-hydroxybenzoate polyprenyltransferase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0607500 PE=3 SV=1
15	Q9VHS7	0.001	43.5	392	0.115	0.130	COQ2_DROME 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Coq2 PE=2 SV=1
16	A0A0B5L778	0.061	37.7	331	0.079	0.106	MPAA2_PENBR Polyprenyl transferase mpaA' OS=Penicillium brevicompactum OX=5074 GN=mpaA' PE=1 SV=1
17	Q69ZZ9	0.067	38.5	3305	0.068	0.009	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
18	D3ZHV2	0.088	38.1	5430	0.068	0.006	MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus OX=10116 GN=Macf1 PE=1 SV=1
19	W6QIT8	0.091	37.4	325	0.074	0.102	MPAA_PENRF Polyprenyl transferase mpaA OS=Penicillium roqueforti (strain FM164) OX=1365484 GN=mpaA PE=3 SV=1
20	F4JPA9	0.10	37.4	429	0.108	0.112	F4JPA9_ARATH 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PPT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01040 UbiA	6.2e-54	194.5	UbiA prenyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261643

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000016171	0.997	Cytochrome c oxidase assembly protein COX15 homolog
2	9606.ENSP00000354499	0.977	Cytochrome c oxidase subunit 1
3	9606.ENSP00000354982	0.968	Cytochrome c oxidase subunit 3
4	9606.ENSP00000372326	0.962	Ferrochelatase, mitochondrial
5	9606.ENSP00000354876	0.958	Cytochrome c oxidase subunit 2
6	9606.ENSP00000326579	0.955	Cytochrome c-type heme lyase
7	9606.ENSP00000361042	0.955	Surfeit locus protein 1
8	9606.ENSP00000317159	0.936	Cytochrome c1, heme protein, mitochondrial
9	9606.ENSP00000255390	0.917	Protein SCO1 homolog, mitochondrial
10	9606.ENSP00000216117	0.913	Heme oxygenase 1
11	9606.ENSP00000477572	0.910	Heme oxygenase 2
12	9606.ENSP00000317780	0.909	Cytochrome c oxidase subunit 5A, mitochondrial
13	9606.ENSP00000413908	0.900	Mitochondrial chaperone BCS1
14	9606.ENSP00000246554	0.895	Cytochrome c oxidase subunit 6B1
15	9606.ENSP00000299335	0.885	Cytochrome c oxidase assembly protein COX11, mitochondrial
16	9606.ENSP00000444433	0.882	Protein SCO2 homolog, mitochondrial
17	9606.ENSP00000354554	0.868	Cytochrome b
18	9606.ENSP00000287490	0.854	Cytochrome c oxidase subunit 6A2, mitochondrial
19	9606.ENSP00000306397	0.843	Cytochrome b-c1 complex subunit Rieske, mitochondrial
20	9606.ENSP00000339720	0.840	Cytochrome c oxidase subunit NDUFA4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004311	1.000	farnesyltranstransferase activity
GO:0008495	0.982	protoheme IX farnesyltransferase activity
GO:0005488	0.728	binding
GO:0005515	0.633	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0046148	0.997	pigment biosynthetic process
GO:0042168	0.997	heme metabolic process
GO:0006779	0.997	porphyrin-containing compound biosynthetic process
GO:0006783	0.994	heme biosynthetic process
GO:0017004	0.993	cytochrome complex assembly
GO:0006091	0.499	generation of precursor metabolites and energy
GO:0008535	0.456	respiratory chain complex IV assembly
GO:0007005	0.437	mitochondrion organization
GO:0009060	0.388	aerobic respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.978	membrane
GO:0031090	0.960	organelle membrane
GO:0005740	0.933	mitochondrial envelope
GO:0043233	0.918	organelle lumen
GO:0031966	0.917	mitochondrial membrane
GO:0070013	0.898	intracellular organelle lumen
GO:0043232	0.866	intracellular non-membrane-bounded organelle
GO:0005743	0.852	mitochondrial inner membrane
GO:0032991	0.851	protein-containing complex
GO:0031981	0.792	nuclear lumen
GO:0005829	0.653	cytosol
GO:1902494	0.439	catalytic complex
GO:0070069	0.338	cytochrome complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17653	1.000	(2E,6E)-farnesyl diphosphate + isopentenyl diphosphate = (2E,6E,10E)-geranylgeranyl diphosphate + diphosphate
EC:2.5.1.29	1.000	geranylgeranyl diphosphate synthase.
RHEA:28070	0.982	(2E,6E)-farnesyl diphosphate + H2O + heme b = diphosphate + Fe(II)-heme o
EC:2.5.1.141	0.982	heme o synthase.

[back to server]