StarFunc result for job id Q12888

User Input

>input (1972 residues)
MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLD
VVSNPEQTAGEERGDGNSGFNEHLKENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSV
LGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQD
VEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTA
QPSKDVHVVKEQNPPPARSEDMPFSPKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVL
STQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSLSTNSS
DLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENP
PLLPESTVSPQASTPISQSTPVFPPGSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDM
HSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDG
ENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISIL
ATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSS
GSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVET
SVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEK
CSDSQSWEDIAPEIEPCAENRLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRA
DDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSFCESSS
ETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESM
VETHDPILGSGKGDSGAAPDVDDKLCLRMKLVSPETEASEESLQFNLEKPATGERKNGST
AVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGD
HTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPS
KALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTER
GSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHMRTIREVRTLVTRVITDVYYV
DGTEVERKVTEETEEPIVECQECETEVSPSQTGGSSGDLGDISSFSSKASSLHRTSSGTS
LSAMHSSGSSGKGAGPLRGKTSGTEPADFALPSSRGGPGKLSPRKGVSQTGTPVCEEDGD
AGLGIRQGGKAPVTPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFSRVV
PRVPDSTRRTDVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRVVAKWSSNGY
FYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKG
HRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLD
NLVEGKRKRRSNVSSPATPTASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPA
KRGRKSATVKPGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMAT
TSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAY
QCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRIL
DWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVV
VTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1M842	0.372	0.372	0.000	1972	0.819	0.819	F1M842.pdb.gz	F1M842_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=3
2	AFDB:Q12888	1.000	1.000	0.000	1972	1.000	1.000	Q12888.pdb.gz	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
3	AFDB:C9JXV0	0.034	0.051	3.175E-89	1033	0.521	0.994	C9JXV0.pdb.gz	C9JXV0_HUMAN Tumor protein p53 binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=1
4	AFDB:A0A1D8PNH8	0.099	0.161	1.962E-16	1174	0.086	0.144	A0A1D8PNH8.pdb.gz	A0A1D8PNH8_CANAL Chromatin-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD9 PE=4 SV=1
5	AFDB:P14737	0.088	0.127	1.248E-13	1309	0.110	0.166	P14737.pdb.gz	RAD9_YEAST DNA repair protein RAD9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD9 PE=1 SV=2
6	AFDB:Q14676	0.081	0.077	4.503E-8	2089	0.158	0.149	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
7	AFDB:P48754	0.086	0.093	4.685E-7	1812	0.151	0.164	P48754.pdb.gz	BRCA1_MOUSE Breast cancer type 1 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca1 PE=1 SV=3
8	AFDB:Q99KW3	0.042	0.042	1.469E-6	2014	0.148	0.144	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
9	AFDB:Q5PSV9	0.090	0.102	2.915E-6	1707	0.164	0.190	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
10	AFDB:P38398	0.087	0.091	4.106E-6	1863	0.138	0.146	P38398.pdb.gz	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2
11	PDB:3mp8A	0.045	0.140	8.168E-5	513	0.015	0.057	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
12	PDB:7abi7	0.035	0.203	2.820E-3	236	0.005	0.038	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
13	PDB:7lsyY	0.042	0.091	5.927E-3	855	0.016	0.037	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
14	PDB:7m8eF	0.040	0.075	8.841E-3	967	0.010	0.020	7m8eF.pdb.gz	Structural basis for activation of Swi2/Snf2 ATPase RapA by RNA polymerase.
15	PDB:6tedZ	0.023	0.083	1.755E-2	510	0.009	0.033	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
16	PDB:6z4cA	0.034	0.402	1.858E-2	127	0.012	0.181	6z4cA.pdb.gz
17	PDB:1k9aB	0.025	0.098	2.205E-2	441	0.009	0.039	1k9aB.pdb.gz
18	PDB:4v6xCA	0.034	0.169	2.617E-2	255	0.014	0.106	4v6xCA.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:4a26A	0.041	0.174	4.134E-2	296	0.011	0.074	4a26A.pdb.gz
20	PDB:7k041	0.027	0.083	4.377E-2	487	0.008	0.031	7k041.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AB98	0.0	2984	1944	0.811	0.823	A0A8I6AB98_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=1
2	A0A8I6AKV2	0.0	2893	1932	0.798	0.815	A0A8I6AKV2_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=1
3	A6NNK5	0.0	3887	1927	0.975	0.997	A6NNK5_HUMAN Tumor protein p53 binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
4	C9JXV0	0.0	2026	1033	0.521	0.995	C9JXV0_HUMAN Tumor protein p53 binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=1
5	F1M842	0.0	2996	1972	0.818	0.818	F1M842_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=3
6	P70399	0.0	3014	1969	0.808	0.810	TP53B_MOUSE TP53-binding protein 1 OS=Mus musculus OX=10090 GN=Tp53bp1 PE=1 SV=3
7	Q12888	0.0	4017	1972	1.000	1.000	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
8	Q98U15	0.0	926	2104	0.292	0.274	Q98U15_XENLA Tumor protein p53 binding protein 1 S homeolog OS=Xenopus laevis OX=8355 GN=tp53bp1.S PE=2 SV=1
9	A0A1D8PNH8	1.10e-05	53.1	1174	0.032	0.055	A0A1D8PNH8_CANAL Chromatin-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD9 PE=4 SV=1
10	P87074	1.94e-04	48.9	778	0.022	0.055	RHP9_SCHPO DNA repair protein crb2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crb2 PE=1 SV=1
11	Q9H461	0.004	44.7	694	0.020	0.056	FZD8_HUMAN Frizzled-8 OS=Homo sapiens OX=9606 GN=FZD8 PE=1 SV=1
12	Q61091	0.022	42.4	685	0.019	0.055	FZD8_MOUSE Frizzled-8 OS=Mus musculus OX=10090 GN=Fzd8 PE=1 SV=2
13	P48754	0.069	40.8	1812	0.022	0.024	BRCA1_MOUSE Breast cancer type 1 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca1 PE=1 SV=3
14	Q9YI00	0.23	38.9	579	0.018	0.060	Q9YI00_DANRE Frizzled 8a protein OS=Danio rerio OX=7955 GN=zg05 PE=2 SV=1
15	P38398	0.50	38.1	1863	0.019	0.020	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2
16	Q9GKK8	0.57	37.7	1863	0.019	0.020	BRCA1_PANTR Breast cancer type 1 susceptibility protein homolog OS=Pan troglodytes OX=9598 GN=BRCA1 PE=2 SV=2
17	Q9PWK6	1.1	36.6	576	0.016	0.054	Q9PWK6_DANRE Frizzled 8b protein OS=Danio rerio OX=7955 GN=ZG06 PE=2 SV=1
18	L7RRS0	1.6	36.2	1686	0.021	0.025	L7RRS0_HUMAN Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=3 SV=1
19	O00443	1.6	36.2	1686	0.021	0.025	P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2
20	Q9XYB7	1.8	35.8	560	0.017	0.059	NHR8_CAEEL Nuclear hormone receptor family member nhr-8 OS=Caenorhabditis elegans OX=6239 GN=nhr-8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09038 53-BP1_Tudor	8.3e-74	256.7	Tumour suppressor p53-binding protein-1 Tudor
2	PF00533 BRCT	0.18	23.5	BRCA1 C Terminus (BRCT) domain
3	PF16589 BRCT_2	10	17.9	BRCT domain, a BRCA1 C-terminus domain
4	PF18428 BRCT_3	1.3e-37	139.3	BRCA1 C Terminus (BRCT) domain
5	PF15057 DUF4537	48	15.3	Domain of unknown function (DUF4537)
6	PF16770 RTT107_BRCT_5	52	15.1	Regulator of Ty1 transposition protein 107 BRCT domain
7	PF18104 Tudor_2	1e+02	14.0	Jumonji domain-containing protein 2A Tudor domain
8	PF18359 Tudor_5	0.25	22.5	Histone methyltransferase Tudor domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371475

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244537	0.999	Histone cluster 1 H4 family member f
2	9606.ENSP00000260810	0.999	DNA topoisomerase 2-binding protein 1
3	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
4	9606.ENSP00000278616	0.999	Serine-protein kinase ATM
5	9606.ENSP00000365588	0.999	Mediator of DNA damage checkpoint protein 1
6	9606.ENSP00000384048	0.999	PAX-interacting protein 1
7	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
8	9606.ENSP00000434024	0.999	Histone H2AX
9	9606.ENSP00000372023	0.998	Serine/threonine-protein kinase Chk2
10	9606.ENSP00000325863	0.997	Double-strand break repair protein MRE11
11	9606.ENSP00000362578	0.997	E3 ubiquitin-protein ligase RNF8
12	9606.ENSP00000388648	0.997	Serine/threonine-protein kinase Chk1
13	9606.ENSP00000320898	0.996	E3 ubiquitin-protein ligase RNF168
14	9606.ENSP00000003302	0.995	Ubiquitin carboxyl-terminal hydrolase 28
15	9606.ENSP00000367034	0.992	Histone cluster 1 H4 family member c
16	9606.ENSP00000243326	0.991	Telomere-associated protein RIF1
17	9606.ENSP00000366434	0.991	BRCA1-A complex subunit RAP80
18	9606.ENSP00000300093	0.990	Serine/threonine-protein kinase PLK1
19	9606.ENSP00000352257	0.989	X-ray repair cross-complementing protein 6
20	9606.ENSP00000475814	0.989	Histone H2A type 2-A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003712	0.999	transcription coregulator activity
GO:0002039	0.999	p53 binding
GO:0140035	0.999	ubiquitination-like modification-dependent protein binding
GO:0061629	0.999	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0035064	0.999	methylated histone binding
GO:0140036	0.990	ubiquitin-dependent protein binding
GO:0061649	0.981	ubiquitin modification-dependent histone binding
GO:0003676	0.807	nucleic acid binding
GO:0003677	0.761	DNA binding
GO:0003684	0.347	damaged DNA binding
GO:0042162	0.328	telomeric DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050896	0.986	response to stimulus
GO:0008152	0.940	metabolic process
GO:0050789	0.934	regulation of biological process
GO:0051716	0.928	cellular response to stimulus
GO:0044237	0.921	cellular metabolic process
GO:0019222	0.919	regulation of metabolic process
GO:0050794	0.907	regulation of cellular process
GO:0044238	0.901	primary metabolic process
GO:0006807	0.901	nitrogen compound metabolic process
GO:0071704	0.899	organic substance metabolic process
GO:0043170	0.881	macromolecule metabolic process
GO:0051171	0.877	regulation of nitrogen compound metabolic process
GO:0060255	0.875	regulation of macromolecule metabolic process
GO:0080090	0.873	regulation of primary metabolic process
GO:0031323	0.866	regulation of cellular metabolic process
GO:0006950	0.863	response to stress
GO:0019219	0.853	regulation of nucleobase-containing compound metabolic process
GO:0033554	0.845	cellular response to stress
GO:0006974	0.842	cellular response to DNA damage stimulus
GO:0046483	0.839	heterocycle metabolic process
GO:0048518	0.836	positive regulation of biological process
GO:0034641	0.830	cellular nitrogen compound metabolic process
GO:0044260	0.827	cellular macromolecule metabolic process
GO:0048519	0.819	negative regulation of biological process
GO:0009314	0.812	response to radiation
GO:0006281	0.805	DNA repair
GO:0048523	0.800	negative regulation of cellular process
GO:0009893	0.798	positive regulation of metabolic process
GO:0048522	0.796	positive regulation of cellular process
GO:0010604	0.779	positive regulation of macromolecule metabolic process
GO:0009892	0.778	negative regulation of metabolic process
GO:0051173	0.775	positive regulation of nitrogen compound metabolic process
GO:0010605	0.757	negative regulation of macromolecule metabolic process
GO:0010468	0.754	regulation of gene expression
GO:0031325	0.748	positive regulation of cellular metabolic process
GO:0051052	0.748	regulation of DNA metabolic process
GO:0031326	0.729	regulation of cellular biosynthetic process
GO:0010556	0.726	regulation of macromolecule biosynthetic process
GO:0051252	0.721	regulation of RNA metabolic process
GO:0045935	0.702	positive regulation of nucleobase-containing compound metabolic process
GO:0051172	0.698	negative regulation of nitrogen compound metabolic process
GO:0031324	0.698	negative regulation of cellular metabolic process
GO:0006355	0.639	regulation of DNA-templated transcription
GO:0048583	0.638	regulation of response to stimulus
GO:0045934	0.631	negative regulation of nucleobase-containing compound metabolic process
GO:0071840	0.561	cellular component organization or biogenesis
GO:0010212	0.552	response to ionizing radiation
GO:0071478	0.550	cellular response to radiation
GO:0016043	0.535	cellular component organization
GO:0071479	0.447	cellular response to ionizing radiation
GO:0006302	0.423	double-strand break repair
GO:0010165	0.402	response to X-ray
GO:2001020	0.348	regulation of response to DNA damage stimulus
GO:0006282	0.313	regulation of DNA repair
GO:0051054	0.310	positive regulation of DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.988	nuclear body
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0005737	0.714	cytoplasm
GO:0005694	0.655	chromosome
GO:0035861	0.470	site of double-strand break
GO:0032991	0.454	protein-containing complex
GO:0000781	0.444	chromosome, telomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]