StarFunc result for job id Q12891

User Input

>input (473 residues)
MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAF
DVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHY
IRTQESAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFE
FAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR
RLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSW
ATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12891	1.000	1.000	1.227E-102	473	1.000	1.000	Q12891.pdb.gz	HYAL2_HUMAN Hyaluronidase-2 OS=Homo sapiens OX=9606 GN=HYAL2 PE=1 SV=4
2	AFDB:O35632	0.933	0.933	7.572E-87	473	0.820	0.820	O35632.pdb.gz	HYAL2_MOUSE Hyaluronidase-2 OS=Mus musculus OX=10090 GN=Hyal2 PE=1 SV=2
3	AFDB:G3V6V8	0.879	0.864	2.897E-56	481	0.374	0.368	G3V6V8.pdb.gz	G3V6V8_RAT Hyaluronidase OS=Rattus norvegicus OX=10116 GN=Hyal4 PE=3 SV=1
4	AFDB:Q2M3T9	0.873	0.858	1.508E-55	481	0.366	0.360	Q2M3T9.pdb.gz	HYAL4_HUMAN Hyaluronidase-4 OS=Homo sapiens OX=9606 GN=HYAL4 PE=1 SV=2
5	AFDB:F1MZM9	0.844	0.726	3.619E-53	552	0.385	0.330	F1MZM9.pdb.gz	F1MZM9_BOVIN Hyaluronidase OS=Bos taurus OX=9913 GN=LOC509761 PE=3 SV=3
6	AFDB:Q812F3	0.854	0.770	1.176E-52	526	0.368	0.331	Q812F3.pdb.gz	HYAL5_MOUSE Hyaluronidase-5 OS=Mus musculus OX=10090 GN=Hyal5 PE=1 SV=1
7	AFDB:Q91ZJ9	0.820	0.839	3.006E-51	462	0.362	0.370	Q91ZJ9.pdb.gz	HYAL1_MOUSE Hyaluronidase-1 OS=Mus musculus OX=10090 GN=Hyal1 PE=1 SV=3
8	AFDB:P38568	0.839	0.780	3.587E-51	510	0.359	0.333	P38568.pdb.gz	HYALP_MACFA Hyaluronidase PH-20 OS=Macaca fascicularis OX=9541 GN=SPAM1 PE=2 SV=1
9	AFDB:Q62803	0.841	0.778	7.275E-51	512	0.355	0.328	Q62803.pdb.gz	HYALP_RAT Hyaluronidase PH-20 OS=Rattus norvegicus OX=10116 GN=Spam1 PE=2 SV=1
10	AFDB:P48794	0.833	0.771	6.070E-50	512	0.345	0.318	P48794.pdb.gz	HYALP_MOUSE Hyaluronidase PH-20 OS=Mus musculus OX=10090 GN=Spam1 PE=1 SV=2
11	PDB:2pe4A	0.837	0.946	8.472E-49	417	0.368	0.417	2pe4A.pdb.gz
12	PDB:3odmC	0.209	0.193	3.414E-3	530	0.068	0.060	3odmC.pdb.gz	Structure of an archaeal-type phosphoenolpyruvate carboxylase sensitive to inhibition by aspartate.
13	PDB:3ho8D	0.249	0.146	4.322E-3	934	0.085	0.043	3ho8D.pdb.gz	A Symmetrical Tetramer for S. aureus Pyruvate Carboxylase in Complex with Coenzyme A.
14	PDB:3wh9A	0.281	0.350	4.322E-3	345	0.070	0.096	3wh9A.pdb.gz
15	PDB:4xuyA	0.186	0.264	7.345E-3	302	0.057	0.089	4xuyA.pdb.gz
16	PDB:1eixC	0.185	0.304	7.791E-3	232	0.053	0.108	1eixC.pdb.gz	Structural basis for the catalytic mechanism of a proficient enzyme: orotidine 5'-monophosphate decarboxylase.
17	PDB:3vzxB	0.183	0.299	1.404E-2	228	0.051	0.105	3vzxB.pdb.gz	Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
18	PDB:4h3dB	0.223	0.340	1.580E-2	254	0.068	0.126	4h3dB.pdb.gz	1.95 Angstrom Crystal Structure of of Type I 3-Dehydroquinate Dehydratase (aroD) from Clostridium difficile with Covalent Modified Comenic Acid.
19	PDB:5bxaA	0.262	0.289	1.580E-2	414	0.095	0.109	5bxaA.pdb.gz	Characterization of the Pseudomonas aeruginosa Glycoside Hydrolase PslG Reveals That Its Levels Are Critical for Psl Polysaccharide Biosynthesis and Biofilm Formation.
20	PDB:6k0kC	0.236	0.270	1.580E-2	397	0.078	0.093	6k0kC.pdb.gz	Crystal structure of Escherichia coli pyruvate kinase II

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35632	0.0	816	473	0.820	0.820	HYAL2_MOUSE Hyaluronidase-2 OS=Mus musculus OX=10090 GN=Hyal2 PE=1 SV=2
2	Q12891	0.0	980	473	1.000	1.000	HYAL2_HUMAN Hyaluronidase-2 OS=Homo sapiens OX=9606 GN=HYAL2 PE=1 SV=4
3	Q9Z2Q3	0.0	811	473	0.814	0.814	HYAL2_RAT Hyaluronidase-2 OS=Rattus norvegicus OX=10116 GN=Hyal2 PE=2 SV=1
4	F1MZM9	1.80e-117	357	552	0.383	0.328	F1MZM9_BOVIN Hyaluronidase OS=Bos taurus OX=9913 GN=LOC509761 PE=3 SV=3
5	Q05A56	6.81e-117	353	481	0.374	0.368	HYAL4_MOUSE Hyaluronidase-4 OS=Mus musculus OX=10090 GN=Hyal4 PE=2 SV=1
6	G3V6V8	2.78e-115	349	481	0.362	0.356	G3V6V8_RAT Hyaluronidase OS=Rattus norvegicus OX=10116 GN=Hyal4 PE=3 SV=1
7	Q812F3	5.54e-114	347	526	0.366	0.329	HYAL5_MOUSE Hyaluronidase-5 OS=Mus musculus OX=10090 GN=Hyal5 PE=1 SV=1
8	Q2M3T9	9.95e-114	345	481	0.364	0.358	HYAL4_HUMAN Hyaluronidase-4 OS=Homo sapiens OX=9606 GN=HYAL4 PE=1 SV=2
9	P38568	1.25e-112	343	510	0.366	0.339	HYALP_MACFA Hyaluronidase PH-20 OS=Macaca fascicularis OX=9541 GN=SPAM1 PE=2 SV=1
10	Q62803	7.07e-112	342	512	0.353	0.326	HYALP_RAT Hyaluronidase PH-20 OS=Rattus norvegicus OX=10116 GN=Spam1 PE=2 SV=1
11	P38567	2.00e-110	338	509	0.355	0.330	HYALP_HUMAN Hyaluronidase PH-20 OS=Homo sapiens OX=9606 GN=SPAM1 PE=1 SV=1
12	P48794	3.57e-106	327	512	0.351	0.324	HYALP_MOUSE Hyaluronidase PH-20 OS=Mus musculus OX=10090 GN=Spam1 PE=1 SV=2
13	Q12794	1.47e-104	320	435	0.372	0.405	HYAL1_HUMAN Hyaluronidase-1 OS=Homo sapiens OX=9606 GN=HYAL1 PE=1 SV=2
14	O43820	1.36e-101	312	417	0.389	0.441	HYAL3_HUMAN Hyaluronidase-3 OS=Homo sapiens OX=9606 GN=HYAL3 PE=1 SV=1
15	Q91ZJ9	3.32e-101	312	462	0.357	0.366	HYAL1_MOUSE Hyaluronidase-1 OS=Mus musculus OX=10090 GN=Hyal1 PE=1 SV=3
16	Q8VEI3	1.22e-90	283	412	0.351	0.403	HYAL3_MOUSE Hyaluronidase-3 OS=Mus musculus OX=10090 GN=Hyal3 PE=1 SV=2
17	Q76HN0	1.64e-69	224	266	0.233	0.414	Q76HN0_RAT Hyaluronidase (Fragment) OS=Rattus norvegicus OX=10116 GN=Hyal4 PE=2 SV=1
18	P86100	1.08e-65	219	410	0.271	0.312	HYAL1_MESMA Hyaluronidase-1 OS=Mesobuthus martensii OX=34649 PE=1 SV=2
19	G5ECE8	1.94e-46	169	458	0.243	0.251	G5ECE8_CAEEL Hyaluronidase OS=Caenorhabditis elegans OX=6239 GN=chhy-1 PE=1 SV=1
20	E0XKJ9	6.83e-45	162	349	0.226	0.307	HUGA_TABYA Hyaluronidase Tab y 2.0101 OS=Tabanus yao OX=485572 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	11	17.8	EGF-like domain
2	PF01630 Glyco_hydro_56	7.5e-136	464.1	Hyaluronidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401853

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398632	0.991	CD44 antigen
2	9606.ENSP00000457230	0.988	WW domain-containing oxidoreductase
3	9606.ENSP00000302728	0.928	Beta-glucuronidase
4	9606.ENSP00000264914	0.924	Arylsulfatase B
5	9606.ENSP00000247933	0.910	Alpha-L-iduronidase
6	9606.ENSP00000296474	0.862	Macrophage-stimulating protein receptor
7	9606.ENSP00000306991	0.849	Hyaluronan synthase 2
8	9606.ENSP00000377492	0.824	Hyaluronan mediated motility receptor
9	9606.ENSP00000341551	0.808	Mothers against decapentaplegic homolog 4
10	9606.ENSP00000263980	0.789	Sodium/hydrogen exchanger 1
11	9606.ENSP00000262013	0.769	C-Jun-amino-terminal kinase-interacting protein 4
12	9606.ENSP00000256178	0.706	Lymphatic vessel endothelial hyaluronic acid receptor 1
13	9606.ENSP00000221930	0.695	Transforming growth factor beta-1
14	9606.ENSP00000373539	0.691	Stabilin-2
15	9606.ENSP00000391209	0.686	Cytochrome b561 family member D2
16	9606.ENSP00000222115	0.663	Hyaluronan synthase 1
17	9606.ENSP00000277903	0.624	Hyaluronan-binding protein 2
18	9606.ENSP00000366243	0.616	Cell surface hyaluronidase
19	9606.ENSP00000387356	0.615	Aggrecan core protein
20	9606.ENSP00000369371	0.614	Equatorin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004415	0.999	hyalurononglucosaminidase activity
GO:0005515	0.986	protein binding
GO:0005102	0.788	signaling receptor binding
GO:0098772	0.775	molecular function regulator activity
GO:0019899	0.494	enzyme binding
GO:0140272	0.475	exogenous protein binding
GO:0001618	0.468	virus receptor activity
GO:0019887	0.355	protein kinase regulator activity
GO:0005539	0.342	glycosaminoglycan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0065007	0.971	biological regulation
GO:0009987	0.965	cellular process
GO:0006026	0.954	aminoglycan catabolic process
GO:1903510	0.942	mucopolysaccharide metabolic process
GO:0006027	0.937	glycosaminoglycan catabolic process
GO:0032501	0.923	multicellular organismal process
GO:0050794	0.868	regulation of cellular process
GO:0050896	0.853	response to stimulus
GO:0032502	0.699	developmental process
GO:0048856	0.631	anatomical structure development
GO:0048518	0.578	positive regulation of biological process
GO:0044238	0.544	primary metabolic process
GO:0006950	0.524	response to stress
GO:0048522	0.458	positive regulation of cellular process
GO:0007275	0.440	multicellular organism development
GO:0048519	0.410	negative regulation of biological process
GO:0048523	0.391	negative regulation of cellular process
GO:0048583	0.372	regulation of response to stimulus
GO:0051716	0.371	cellular response to stimulus
GO:0051171	0.357	regulation of nitrogen compound metabolic process
GO:0031323	0.349	regulation of cellular metabolic process
GO:0080090	0.348	regulation of primary metabolic process
GO:0060255	0.341	regulation of macromolecule metabolic process
GO:0009893	0.331	positive regulation of metabolic process
GO:0009966	0.322	regulation of signal transduction
GO:0048731	0.315	system development
GO:0010604	0.304	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005886	0.999	plasma membrane
GO:0005634	0.984	nucleus
GO:0012505	0.958	endomembrane system
GO:0005576	0.947	extracellular region
GO:0098857	0.932	membrane microdomain
GO:0009986	0.896	cell surface
GO:0032991	0.890	protein-containing complex
GO:0045121	0.890	membrane raft
GO:0031982	0.840	vesicle
GO:0097708	0.679	intracellular vesicle
GO:0031410	0.665	cytoplasmic vesicle
GO:0000323	0.530	lytic vacuole
GO:0005764	0.516	lysosome
GO:0070013	0.467	intracellular organelle lumen
GO:0031090	0.436	organelle membrane
GO:0005615	0.400	extracellular space
GO:0005794	0.394	Golgi apparatus
GO:0070062	0.375	extracellular exosome
GO:0098552	0.301	side of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.35	0.999	hyaluronoglucosaminidase.

[back to server]