StarFunc result for job id Q12894

User Input

>input (506 residues)
MAWNSPSRRPVWQGGAPREDGGARGVWLPSSGQVSAQRTGRRLVGLEPTPTGSLTPRPPR
PVPGMPRARKGNTLRKGGQRRGGGARSSAQADSGSSDDEAASEARSTASECPSLLSTTAE
DSLGGDVVDEQGQQEDLEEKLKEYVDCLTDKSAKTRQGALESLRLALASRLLPDFLLERR
LTLADALEKCLKKGKGEEQALAAAVLGLLCVQLGPGPKGEELFHSLQPLLVSVLSDSTAS
PAARLHCASALGLGCYVAAADIQDLVSCLACLESVFSRFYGLGGSSTSPVVPASLHGLLS
AALQAWALLLTICPSTQISHILDRQLPRLPQLLSSESVNLRIAAGETIALLFELARDLEE
EFVYEDMEALCSVLRTLATDSNKYRAKADRRRQRSTFRAVLHSVEGGECEEEIVRFGFEV
LYMDSWARHRIYAAFKEVLGSGMHHHLQNNELLRDIFGLGPVLLLDATALKACKVPRFEK
HLYNAAAFKARTKARSRVRDKRADIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12894	1.000	1.000	5.122E-66	506	1.000	1.000	Q12894.pdb.gz	IFRD2_HUMAN Interferon-related developmental regulator 2 OS=Homo sapiens OX=9606 GN=IFRD2 PE=1 SV=4
2	AFDB:O00458	0.771	0.863	1.728E-36	451	0.439	0.492	O00458.pdb.gz	IFRD1_HUMAN Interferon-related developmental regulator 1 OS=Homo sapiens OX=9606 GN=IFRD1 PE=1 SV=4
3	AFDB:Q9VQI5	0.728	0.860	4.348E-24	425	0.308	0.367	Q9VQI5.pdb.gz	Q9VQI5_DROME Interferon-related developmental regulator 1 OS=Drosophila melanogaster OX=7227 GN=Ifrd1 PE=1 SV=2
4	AFDB:F4HUS5	0.565	0.644	3.722E-17	441	0.202	0.231	F4HUS5.pdb.gz	F4HUS5_ARATH Interferon-related developmental regulator family protein / IFRD protein family OS=Arabidopsis thaliana OX=3702 GN=SAT32 PE=1 SV=1
5	AFDB:Q14669	0.313	0.101	4.343E-5	1992	0.128	0.033	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
6	AFDB:F4ILG6	0.283	0.192	7.895E-5	829	0.150	0.092	F4ILG6.pdb.gz	F4ILG6_ARATH RING-type E3 ubiquitin transferase OS=Arabidopsis thaliana OX=3702 GN=PUB4 PE=1 SV=1
7	AFDB:B2RY50	0.347	0.186	1.210E-4	1037	0.109	0.053	B2RY50.pdb.gz	ODAD2_MOUSE Outer dynein arm-docking complex subunit 2 OS=Mus musculus OX=10090 GN=Odad2 PE=1 SV=1
8	AFDB:E7FB07	0.343	0.180	1.435E-4	1047	0.097	0.047	E7FB07.pdb.gz	E7FB07_DANRE Armadillo repeat containing 4 OS=Danio rerio OX=7955 GN=armc4 PE=1 SV=1
9	AFDB:Q86DA5	0.300	0.174	3.094E-4	981	0.146	0.075	Q86DA5.pdb.gz	SARM1_CAEEL NAD(+) hydrolase tir-1 OS=Caenorhabditis elegans OX=6239 GN=tir-1 PE=1 SV=2
10	AFDB:Q8NEN0	0.249	0.163	3.516E-4	867	0.134	0.078	Q8NEN0.pdb.gz	ARMC2_HUMAN Armadillo repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=ARMC2 PE=1 SV=4
11	PDB:7bfpC	0.362	0.581	8.279E-4	298	0.099	0.168	7bfpC.pdb.gz
12	PDB:7rroH7	0.292	0.261	1.863E-3	580	0.113	0.098	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:3w3uA	0.377	0.198	1.944E-3	1030	0.111	0.054	3w3uA.pdb.gz
14	PDB:1b3uA	0.279	0.248	2.511E-3	588	0.101	0.087	1b3uA.pdb.gz
15	PDB:4jlqA	0.340	0.225	2.621E-3	840	0.099	0.060	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
16	PDB:5tbkA	0.339	0.400	3.688E-3	417	0.057	0.070	5tbkA.pdb.gz
17	PDB:3tpoA	0.276	0.309	4.016E-3	438	0.099	0.114	3tpoA.pdb.gz
18	PDB:4a0cA	0.294	0.154	4.016E-3	1155	0.087	0.038	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
19	PDB:2z6gA	0.334	0.311	4.191E-3	550	0.085	0.078	2z6gA.pdb.gz
20	PDB:6xu2A	0.411	0.201	4.191E-3	1091	0.087	0.040	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12894	0.0	1017	506	1.000	1.000	IFRD2_HUMAN Interferon-related developmental regulator 2 OS=Homo sapiens OX=9606 GN=IFRD2 PE=1 SV=4
2	O00458	4.99e-146	428	451	0.429	0.481	IFRD1_HUMAN Interferon-related developmental regulator 1 OS=Homo sapiens OX=9606 GN=IFRD1 PE=1 SV=4
3	P19182	4.10e-145	426	449	0.431	0.486	IFRD1_MOUSE Interferon-related developmental regulator 1 OS=Mus musculus OX=10090 GN=Ifrd1 PE=1 SV=2
4	P20695	2.16e-144	424	449	0.429	0.483	IFRD1_RAT Interferon-related developmental regulator 1 OS=Rattus norvegicus OX=10116 GN=Ifrd1 PE=2 SV=1
5	Q9VQI5	8.67e-80	257	425	0.314	0.374	Q9VQI5_DROME Interferon-related developmental regulator 1 OS=Drosophila melanogaster OX=7227 GN=Ifrd1 PE=1 SV=2
6	F4HUS5	1.55e-24	108	441	0.213	0.245	F4HUS5_ARATH Interferon-related developmental regulator family protein / IFRD protein family OS=Arabidopsis thaliana OX=3702 GN=SAT32 PE=1 SV=1
7	O42973	0.001	43.9	446	0.166	0.188	YGZ3_SCHPO Uncharacterized protein C20F10.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC20F10.03 PE=1 SV=1
8	P38812	0.11	36.6	185	0.061	0.168	GEP4_YEAST Phosphatidylglycerophosphatase GEP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GEP4 PE=1 SV=1
9	Q64395	1.3	34.3	535	0.043	0.041	PDE1B_CRIGR Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Cricetulus griseus OX=10029 GN=PDE1B1 PE=2 SV=2
10	Q8ZNR3	2.0	33.5	782	0.081	0.052	SOPA_SALTY E3 ubiquitin-protein ligase SopA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=sopA PE=1 SV=1
11	Q01065	2.9	33.1	535	0.042	0.039	PDE1B_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Mus musculus OX=10090 GN=Pde1b PE=1 SV=2
12	Q01066	3.2	32.7	535	0.042	0.039	PDE1B_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Rattus norvegicus OX=10116 GN=Pde1b PE=1 SV=1
13	Q9S4P4	3.5	32.7	782	0.079	0.051	SOPA_SALDU E3 ubiquitin-protein ligase SopA OS=Salmonella dublin OX=98360 GN=sopA PE=1 SV=1
14	Q09065	4.1	32.0	254	0.036	0.071	UREF_HELPY Urease accessory protein UreF OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=ureF PE=1 SV=2
15	F5HE12	4.5	32.3	641	0.053	0.042	UL35_HCMVM Tegument protein UL35 OS=Human cytomegalovirus (strain Merlin) OX=295027 GN=UL35 PE=3 SV=1
16	P16766	4.7	32.3	640	0.053	0.042	UL35_HCMVA Protein UL35 OS=Human cytomegalovirus (strain AD169) OX=10360 GN=UL35 PE=1 SV=1
17	B7Z637	5.6	32.0	600	0.051	0.043	B7Z637_HUMAN Armadillo repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=ARMC8 PE=1 SV=1
18	Q8IUR7	7.2	32.0	673	0.051	0.039	ARMC8_HUMAN Armadillo repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=ARMC8 PE=1 SV=2
19	G5EAZ4	9.7	31.6	872	0.069	0.040	G5EAZ4_EMENI Importin N-terminal domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00906 PE=4 SV=1
20	A2AMT1	9.8	31.2	669	0.040	0.030	BFSP1_MOUSE Filensin OS=Mus musculus OX=10090 GN=Bfsp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06371 Drf_GBD	1.6e+02	13.2	Diaphanous GTPase-binding Domain
2	PF02985 HEAT	60	15.3	HEAT repeat
3	PF05004 IFRD	7.1e-88	306.2	Interferon-related developmental regulator (IFRD)
4	PF04836 IFRD_C	1.2e-18	78.7	Interferon-related protein conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008970476.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003807066.1	0.798	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
2	9597.XP_003828658.1	0.760	Ubiquitin-like protein fubi and ribosomal protein S30
3	9597.XP_008957426.1	0.730	Hsp70-binding protein 1
4	9597.XP_003816986.1	0.692	Mitochondrial ribosomal protein S2
5	9597.XP_008964239.1	0.663	Solute carrier family 13 member 4 isoform X1
6	9597.XP_003827730.1	0.662	HBS1 like translational GTPase
7	9597.XP_003816691.1	0.649	Belongs to the universal ribosomal protein uS7 family.
8	9597.XP_003819444.1	0.649	Ribosomal protein L8
9	9597.XP_003827718.1	0.643	Belongs to the eukaryotic ribosomal protein eS12 family.
10	9597.XP_003806493.1	0.642	Ribosomal protein L35a
11	9597.XP_003808104.1	0.642	Ribosomal protein L35
12	9597.XP_003808565.1	0.642	Belongs to the universal ribosomal protein uL1 family.
13	9597.XP_003809888.1	0.642	Belongs to the universal ribosomal protein uL14 family.
14	9597.XP_003810030.1	0.642	Ribosomal protein S28
15	9597.XP_003810808.1	0.642	Belongs to the universal ribosomal protein uL5 family.
16	9597.XP_003811021.1	0.642	Binds to the 23S rRNA
17	9597.XP_003812284.1	0.642	Belongs to the universal ribosomal protein uS9 family.
18	9597.XP_003812488.1	0.642	Ribosomal protein S19
19	9597.XP_003814749.1	0.642	Belongs to the universal ribosomal protein uS3 family.
20	9597.XP_003818255.1	0.642	Belongs to the universal ribosomal protein uS15 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.353	organic cyclic compound binding
GO:0003676	0.313	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.761	regulation of biological process
GO:0071840	0.703	cellular component organization or biogenesis
GO:0050794	0.703	regulation of cellular process
GO:0016043	0.658	cellular component organization
GO:0032502	0.310	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005829	0.965	cytosol
GO:0043232	0.643	intracellular non-membrane-bounded organelle
GO:0032991	0.601	protein-containing complex
GO:0070013	0.512	intracellular organelle lumen
GO:0016020	0.466	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]