StarFunc result for job id Q12899

User Input

>input (539 residues)
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKK
LQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
ELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVKKKTGEFSDKLLSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQFDCEPGVLGS
KGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG
DEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAEL
FPALRPRRVGIALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12899	1.000	1.000	1.692E-98	539	1.000	1.000	Q12899.pdb.gz	TRI26_HUMAN Tripartite motif-containing protein 26 OS=Homo sapiens OX=9606 GN=TRIM26 PE=1 SV=1
2	AFDB:Q99PN3	0.778	0.770	2.611E-87	545	0.889	0.879	Q99PN3.pdb.gz	TRI26_MOUSE Tripartite motif-containing protein 26 OS=Mus musculus OX=10090 GN=Trim26 PE=2 SV=3
3	AFDB:Q9UDY6	0.351	0.390	1.108E-48	481	0.358	0.401	Q9UDY6.pdb.gz	TRI10_HUMAN Tripartite motif-containing protein 10 OS=Homo sapiens OX=9606 GN=TRIM10 PE=1 SV=3
4	AFDB:Q9WUH5	0.383	0.416	1.516E-47	489	0.347	0.382	Q9WUH5.pdb.gz	TRI10_MOUSE Tripartite motif-containing protein 10 OS=Mus musculus OX=10090 GN=Trim10 PE=2 SV=2
5	AFDB:Q923T7	0.414	0.434	1.356E-43	510	0.308	0.325	Q923T7.pdb.gz	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
6	AFDB:Q9C029	0.387	0.405	6.485E-42	511	0.302	0.319	Q9C029.pdb.gz	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
7	AFDB:Q9C019	0.426	0.488	2.022E-41	465	0.321	0.372	Q9C019.pdb.gz	TRI15_HUMAN E3 ubiquitin-protein ligase TRIM15 OS=Homo sapiens OX=9606 GN=TRIM15 PE=1 SV=1
8	AFDB:A0A1U9X8R9	0.320	0.334	6.676E-41	513	0.312	0.327	A0A1U9X8R9.pdb.gz	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
9	AFDB:Q5NCC9	0.356	0.391	2.333E-40	485	0.295	0.328	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
10	AFDB:A0A060IVL7	0.322	0.317	4.241E-39	548	0.275	0.270	A0A060IVL7.pdb.gz	A0A060IVL7_DANRE Tripartite motif containing 69 protein OS=Danio rerio OX=7955 GN=TRIM69 PE=2 SV=1
11	PDB:7y4sA	0.331	0.505	4.898E-17	343	0.139	0.219	7y4sA.pdb.gz
12	PDB:4b3nA	0.262	0.254	2.154E-12	557	0.091	0.088	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:4tn3B	0.278	0.394	1.493E-7	362	0.104	0.155	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:7ccbA	0.236	0.698	8.704E-7	164	0.050	0.165	7ccbA.pdb.gz
15	PDB:7z36B	0.214	0.247	1.823E-6	446	0.093	0.112	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
16	PDB:7nscA	0.239	0.441	6.743E-6	276	0.059	0.116	7nscA.pdb.gz
17	PDB:7nsba	0.220	0.210	4.405E-5	568	0.076	0.072	7nsba.pdb.gz
18	PDB:6swy1	0.208	0.207	8.715E-5	542	0.059	0.059	6swy1.pdb.gz
19	PDB:7m6aA	0.180	0.025	3.045E-4	4306	0.045	0.006	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
20	PDB:7tzcA	0.191	0.025	4.534E-4	4404	0.043	0.005	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12899	0.0	1095	539	1.000	1.000	TRI26_HUMAN Tripartite motif-containing protein 26 OS=Homo sapiens OX=9606 GN=TRIM26 PE=1 SV=1
2	Q99PN3	0.0	875	545	0.889	0.879	TRI26_MOUSE Tripartite motif-containing protein 26 OS=Mus musculus OX=10090 GN=Trim26 PE=2 SV=3
3	Q9UDY6	1.07e-104	324	481	0.369	0.414	TRI10_HUMAN Tripartite motif-containing protein 10 OS=Homo sapiens OX=9606 GN=TRIM10 PE=1 SV=3
4	Q9WUH5	2.72e-92	292	489	0.353	0.389	TRI10_MOUSE Tripartite motif-containing protein 10 OS=Mus musculus OX=10090 GN=Trim10 PE=2 SV=2
5	Q9C019	9.77e-84	270	465	0.330	0.383	TRI15_HUMAN E3 ubiquitin-protein ligase TRIM15 OS=Homo sapiens OX=9606 GN=TRIM15 PE=1 SV=1
6	A0A1U9X8R9	4.56e-73	243	513	0.314	0.329	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
7	P14373	4.56e-73	243	513	0.314	0.329	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
8	Q62158	7.33e-73	243	513	0.315	0.331	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
9	Q923T7	7.90e-70	234	510	0.302	0.320	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
10	A0A024RCP5	1.45e-66	226	518	0.315	0.328	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
11	Q9HCM9	1.45e-66	226	518	0.315	0.328	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
12	P19474	2.54e-66	224	475	0.317	0.360	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
13	Q9C029	2.35e-65	223	511	0.304	0.321	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
14	O00635	1.37e-61	211	465	0.302	0.351	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
15	Q8R0K2	4.84e-59	206	507	0.299	0.318	TRI31_MOUSE E3 ubiquitin-protein ligase TRIM31 OS=Mus musculus OX=10090 GN=Trim31 PE=1 SV=1
16	Q3U7K7	2.33e-58	202	462	0.286	0.333	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
17	Q62191	3.62e-58	202	470	0.286	0.328	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
18	Q6AZZ1	7.13e-56	197	485	0.293	0.326	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
19	Q5NCC9	2.09e-55	195	485	0.289	0.322	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
20	Q8BGE7	6.63e-55	194	488	0.289	0.320	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	4.4	18.7	Baculovirus immediate-early protein (IE-0)
2	PF02724 CDC45	6.4e+02	10.0	CDC45-like protein
3	PF18912 DZR_2	71	14.7	Double zinc ribbon domain
4	PF04147 Nop14	24	14.7	Nop14-like family
5	PF14447 Prok-RING_4	0.71	21.1	Prokaryotic RING finger family 4
6	PF13765 PRY	3.5e-11	53.8	SPRY-associated domain
7	PF04641 Rtf2	70	14.2	Rtf2 RING-finger
8	PF00622 SPRY	3.4e-10	51.5	SPRY domain
9	PF00643 zf-B_box	4.4e-05	34.9	B-box zinc finger
10	PF00097 zf-C3HC4	2.9e-05	35.2	Zinc finger, C3HC4 type (RING finger)
11	PF13923 zf-C3HC4_2	4.7e-05	34.4	Zinc finger, C3HC4 type (RING finger)
12	PF13920 zf-C3HC4_3	7.4e-06	37.0	Zinc finger, C3HC4 type (RING finger)
13	PF15227 zf-C3HC4_4	2e-06	39.1	zinc finger of C3HC4-type, RING
14	PF16685 zf-RING_10	12	17.5	zinc RING finger of MSL2
15	PF13639 zf-RING_2	0.001	30.7	Ring finger domain
16	PF14634 zf-RING_5	0.0074	27.6	zinc-RING finger domain
17	PF14835 zf-RING_6	0.0048	28.1	zf-RING of BARD1-type protein
18	PF13445 zf-RING_UBOX	7.2e-05	34.1	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410446

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483825	0.773	NF-kappa-B essential modulator
2	9606.ENSP00000365963	0.726	Protein phosphatase 1 regulatory subunit 11
3	9606.ENSP00000365433	0.710	Transcription factor 19
4	9606.ENSP00000313603	0.692	ATP-binding cassette sub-family F member 1
5	9606.ENSP00000366095	0.680	Myelin-oligodendrocyte glycoprotein
6	9606.ENSP00000291890	0.649	Natural cytotoxicity triggering receptor 1
7	9606.ENSP00000379042	0.638	ERO1-like protein alpha
8	9606.ENSP00000278903	0.611	Etoposide-induced protein 2.4 homolog
9	9606.ENSP00000259915	0.607	POU domain, class 5, transcription factor 1
10	9606.ENSP00000357840	0.602	Sodium-dependent glucose transporter 1
11	9606.ENSP00000295756	0.601	T-cell receptor-associated transmembrane adapter 1
12	9606.ENSP00000363124	0.589	PHD finger protein 20
13	9606.ENSP00000402338	0.581	Ribosome production factor 2 homolog
14	9606.ENSP00000357122	0.577	Pyrin and HIN domain-containing protein 1
15	9606.ENSP00000362562	0.576	Transmembrane protein 54
16	9606.ENSP00000365744	0.576	Proline-rich protein 3
17	9606.ENSP00000357863	0.571	General transcription factor 3C polypeptide 6
18	9606.ENSP00000365806	0.562	Guanine nucleotide-binding protein-like 1
19	9606.ENSP00000419298	0.548	Putative POU domain, class 5, transcription factor 1B
20	9606.ENSP00000351596	0.543	Tetratricopeptide repeat protein 37

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.357	nucleic acid binding
GO:0003824	0.313	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050896	0.989	response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0006950	0.980	response to stress
GO:0006955	0.954	immune response
GO:0009615	0.953	response to virus
GO:0045087	0.937	innate immune response
GO:0050792	0.928	regulation of viral process
GO:0060255	0.917	regulation of macromolecule metabolic process
GO:0051171	0.888	regulation of nitrogen compound metabolic process
GO:0031323	0.888	regulation of cellular metabolic process
GO:0140546	0.888	defense response to symbiont
GO:0080090	0.885	regulation of primary metabolic process
GO:0010468	0.882	regulation of gene expression
GO:0009987	0.871	cellular process
GO:0048519	0.855	negative regulation of biological process
GO:0019219	0.843	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.829	regulation of macromolecule biosynthetic process
GO:0031326	0.827	regulation of cellular biosynthetic process
GO:0051607	0.768	defense response to virus
GO:0048525	0.764	negative regulation of viral process
GO:0043903	0.759	regulation of biological process involved in symbiotic interaction
GO:0051252	0.752	regulation of RNA metabolic process
GO:2001141	0.731	regulation of RNA biosynthetic process
GO:1903900	0.729	regulation of viral life cycle
GO:0006355	0.714	regulation of DNA-templated transcription
GO:0065009	0.712	regulation of molecular function
GO:0051090	0.656	regulation of DNA-binding transcription factor activity
GO:0046596	0.592	regulation of viral entry into host cell
GO:1903901	0.518	negative regulation of viral life cycle
GO:0048518	0.488	positive regulation of biological process
GO:0044093	0.461	positive regulation of molecular function
GO:0048522	0.410	positive regulation of cellular process
GO:0008152	0.405	metabolic process
GO:0071704	0.364	organic substance metabolic process
GO:0048583	0.355	regulation of response to stimulus
GO:0006807	0.329	nitrogen compound metabolic process
GO:0044238	0.328	primary metabolic process
GO:0043170	0.306	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.938	cytosol
GO:0070013	0.921	intracellular organelle lumen
GO:0043231	0.899	intracellular membrane-bounded organelle
GO:0005634	0.862	nucleus
GO:0031981	0.328	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]