StarFunc result for job id Q12904

User Input

>input (312 residues)
MANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVENAKLKKEIE
ELKQELIQAEIQNGVKQIPFPSGTPLHANSMVSENVIQSTAVTTVSSGTKEQIKGGTGDE
KKAKEKIEKKGEKKEKKQQSIAGSADSKPIDVSRLDLRIGCIITARKHPDADSLYVEEVD
VGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILA
PPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGV
CRAQTMSNSGIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12904	1.000	1.000	3.309E-51	312	1.000	1.000	Q12904.pdb.gz	AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2
2	AFDB:P31230	0.639	0.642	2.415E-46	310	0.862	0.868	P31230.pdb.gz	AIMP1_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Mus musculus OX=10090 GN=Aimp1 PE=1 SV=2
3	AFDB:Q4G079	0.811	0.804	9.319E-46	315	0.862	0.854	Q4G079.pdb.gz	Q4G079_RAT Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 OS=Rattus norvegicus OX=10116 GN=Aimp1 PE=1 SV=1
4	AFDB:Q9SVN5	0.524	0.210	4.952E-24	797	0.321	0.125	Q9SVN5.pdb.gz	SYMC_ARATH Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g13780 PE=2 SV=1
5	AFDB:A0A0S2Z4R1	0.528	0.315	2.139E-23	528	0.276	0.163	A0A0S2Z4R1.pdb.gz	A0A0S2Z4R1_HUMAN Tyrosine--tRNA ligase (Fragment) OS=Homo sapiens OX=9606 GN=YARS PE=2 SV=1
6	AFDB:Q6TGS6	0.523	0.311	8.255E-23	529	0.292	0.172	Q6TGS6.pdb.gz	SYYC_DANRE Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio OX=7955 GN=yars1 PE=2 SV=2
7	AFDB:Q54DX3	0.518	0.447	1.622E-22	363	0.276	0.237	Q54DX3.pdb.gz	Q54DX3_DICDI Endothelial monocyte-activating polypeptide II pro-EMAP II family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291926 PE=4 SV=1
8	AFDB:Q93VB0	0.511	0.412	1.099E-21	389	0.301	0.242	Q93VB0.pdb.gz	Q93VB0_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=At2g40660 PE=1 SV=1
9	AFDB:Q6FNN0	0.527	0.439	1.823E-21	376	0.279	0.231	Q6FNN0.pdb.gz	Q6FNN0_CANGA Candida glabrata strain CBS138 chromosome J complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0J10406g PE=4 SV=1
10	AFDB:P46672	0.526	0.438	3.200E-21	376	0.266	0.221	P46672.pdb.gz	ARC1_YEAST tRNA-aminoacylation cofactor ARC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARC1 PE=1 SV=2
11	PDB:7db7B	0.241	0.095	4.617E-4	836	0.061	0.023	7db7B.pdb.gz	Re-discovery of PF-3845 as a new chemical scaffold inhibiting phenylalanyl-tRNA synthetase in Mycobacterium tuberculosis .
12	PDB:3pcoB	0.213	0.089	5.783E-4	795	0.090	0.035	3pcoB.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
13	PDB:2pi2A	0.173	0.371	3.720E-2	129	0.051	0.124	2pi2A.pdb.gz
14	PDB:6dt1A	0.163	0.115	9.683E-2	464	0.038	0.026	6dt1A.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
15	PDB:1u5kA	0.174	0.217	1.213E-1	242	0.045	0.058	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
16	PDB:3q8dB	0.165	0.214	1.607E-1	232	0.032	0.043	3q8dB.pdb.gz	Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein.
17	PDB:7a5fJ6	0.167	0.424	2.012E-1	108	0.029	0.083	7a5fJ6.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
18	PDB:4v8mAS	0.168	0.337	2.520E-1	142	0.029	0.063	4v8mAS.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
19	PDB:4ifdH	0.186	0.195	3.157E-1	295	0.045	0.047	4ifdH.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
20	PDB:3jd5L	0.155	0.381	3.339E-1	109	0.035	0.101	3jd5L.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31230	0.0	504	310	0.827	0.832	AIMP1_MOUSE Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Mus musculus OX=10090 GN=Aimp1 PE=1 SV=2
2	Q12904	0.0	633	312	1.000	1.000	AIMP1_HUMAN Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2
3	Q4G079	5.04e-180	501	315	0.849	0.841	Q4G079_RAT Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 OS=Rattus norvegicus OX=10116 GN=Aimp1 PE=1 SV=1
4	A0A8I6A263	5.09e-180	501	321	0.849	0.826	A0A8I6A263_RAT Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 OS=Rattus norvegicus OX=10116 GN=Aimp1 PE=1 SV=1
5	Q9SVN5	9.17e-56	195	797	0.324	0.127	SYMC_ARATH Methionine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g13780 PE=2 SV=1
6	Q6TGS6	8.07e-49	172	529	0.266	0.157	SYYC_DANRE Tyrosine--tRNA ligase, cytoplasmic OS=Danio rerio OX=7955 GN=yars1 PE=2 SV=2
7	A0A0S2Z4R1	8.62e-49	172	528	0.298	0.176	A0A0S2Z4R1_HUMAN Tyrosine--tRNA ligase (Fragment) OS=Homo sapiens OX=9606 GN=YARS PE=2 SV=1
8	P54577	8.62e-49	172	528	0.298	0.176	SYYC_HUMAN Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS1 PE=1 SV=4
9	Q54DX3	1.61e-48	167	363	0.269	0.231	Q54DX3_DICDI Endothelial monocyte-activating polypeptide II pro-EMAP II family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291926 PE=4 SV=1
10	Q6FNN0	3.87e-46	162	376	0.253	0.210	Q6FNN0_CANGA Candida glabrata strain CBS138 chromosome J complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0J10406g PE=4 SV=1
11	P46672	5.90e-46	161	376	0.244	0.202	ARC1_YEAST tRNA-aminoacylation cofactor ARC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARC1 PE=1 SV=2
12	Q9P6K7	7.84e-46	162	450	0.279	0.193	ARC1_SCHPO tRNA-aminoacylation cofactor arc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC30C2.04 PE=3 SV=1
13	Q9VV60	6.98e-42	153	525	0.221	0.131	Q9VV60_DROME Tyrosine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=TyrRS PE=1 SV=1
14	Q93VB0	3.36e-40	146	389	0.240	0.193	Q93VB0_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=At2g40660 PE=1 SV=1
15	Q9M1X8	2.88e-35	130	273	0.234	0.267	Q9M1X8_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=F24G16.250 PE=1 SV=1
16	Q57XN4	4.48e-25	106	425	0.147	0.108	Q57XN4_TRYB2 Tyrosyl-tRNA synthetase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.390 PE=4 SV=1
17	Q57UK5	1.43e-21	92.8	223	0.163	0.229	Q57UK5_TRYB2 Tyrosyl/methionyl-tRNA synthetase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.5H5.270 PE=4 SV=1
18	P00959	8.72e-07	52.8	677	0.135	0.062	SYM_ECOLI Methionine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=metG PE=1 SV=2
19	Q728S0	0.055	37.7	798	0.090	0.035	SYFB_DESVH Phenylalanine--tRNA ligase beta subunit OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=pheT PE=1 SV=1
20	M0QXT0	0.40	34.3	253	0.061	0.075	M0QXT0_HUMAN Upstream transcription factor 2, c-fos interacting (Fragment) OS=Homo sapiens OX=9606 GN=USF2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04880 NUDE_C	83	15.1	NUDE protein, C-terminal conserved region
2	PF01588 tRNA_bind	1.2e-26	104.0	Putative tRNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378191

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223029	0.999	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
2	9606.ENSP00000231572	0.999	Arginine--tRNA ligase, cytoplasmic
3	9606.ENSP00000262027	0.999	Methionine--tRNA ligase, cytoplasmic
4	9606.ENSP00000307567	0.999	Glutamine--tRNA ligase
5	9606.ENSP00000355890	0.999	Bifunctional glutamate/proline--tRNA ligase
6	9606.ENSP00000369038	0.999	Eukaryotic translation elongation factor 1 epsilon-1
7	9606.ENSP00000325448	0.998	Lysine--tRNA ligase
8	9606.ENSP00000364794	0.998	Isoleucine--tRNA ligase, cytoplasmic
9	9606.ENSP00000264161	0.997	Aspartate--tRNA ligase, cytoplasmic
10	9606.ENSP00000377954	0.997	Leucine--tRNA ligase, cytoplasmic
11	9606.ENSP00000358549	0.921	Probable arginine--tRNA ligase, mitochondrial
12	9606.ENSP00000261772	0.873	Alanine--tRNA ligase, cytoplasmic
13	9606.ENSP00000338093	0.861	Probable threonine--tRNA ligase 2, cytoplasmic
14	9606.ENSP00000359910	0.845	Proteasome subunit alpha type-7
15	9606.ENSP00000282276	0.831	Methionine--tRNA ligase, mitochondrial
16	9606.ENSP00000299767	0.828	Endoplasmin
17	9606.ENSP00000408576	0.808	Probable leucine--tRNA ligase, mitochondrial
18	9606.ENSP00000395196	0.806	Probable glutamate--tRNA ligase, mitochondrial
19	9606.ENSP00000387710	0.788	Threonine--tRNA ligase, cytoplasmic
20	9606.ENSP00000223321	0.782	Proteasome subunit alpha type-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	0.997	cytokine activity
GO:1901363	0.985	heterocyclic compound binding
GO:0097159	0.985	organic cyclic compound binding
GO:0003723	0.981	RNA binding
GO:0042802	0.772	identical protein binding
GO:0000049	0.481	tRNA binding
GO:0051020	0.308	GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0065007	0.975	biological regulation
GO:0050789	0.967	regulation of biological process
GO:0050794	0.907	regulation of cellular process
GO:0048519	0.830	negative regulation of biological process
GO:0071704	0.574	organic substance metabolic process
GO:0050896	0.341	response to stimulus
GO:0044238	0.329	primary metabolic process
GO:0044237	0.325	cellular metabolic process
GO:0048523	0.325	negative regulation of cellular process
GO:0006807	0.316	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:1902494	0.996	catalytic complex
GO:0140535	0.996	intracellular protein-containing complex
GO:0005737	0.991	cytoplasm
GO:0005829	0.975	cytosol
GO:0016020	0.953	membrane
GO:0005576	0.941	extracellular region
GO:0017101	0.937	aminoacyl-tRNA synthetase multienzyme complex
GO:0070013	0.933	intracellular organelle lumen
GO:0043231	0.843	intracellular membrane-bounded organelle
GO:0005634	0.822	nucleus
GO:0005615	0.804	extracellular space
GO:0031981	0.552	nuclear lumen
GO:0005654	0.442	nucleoplasm
GO:0009986	0.303	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]