StarFunc result for job id Q12905

User Input

>input (390 residues)
MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKR
NQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVA
DLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTV
PPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPL
TPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHT
VMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEK
PPEKKEGEEEEENTEEPPQGEEEESMETQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F4ZW62	0.947	0.947	3.457E-66	390	1.000	1.000	F4ZW62.pdb.gz	F4ZW62_HUMAN NF45 OS=Homo sapiens OX=9606 PE=1 SV=1
2	PDB:4atbA	0.851	0.993	5.849E-54	334	0.854	0.997	4atbA.pdb.gz	NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
3	AFDB:Q9VG73	0.878	0.865	2.378E-45	396	0.562	0.553	Q9VG73.pdb.gz	ILF2_DROME Interleukin enhancer-binding factor 2 homolog OS=Drosophila melanogaster OX=7227 GN=CG5641 PE=2 SV=1
4	AFDB:Q96KR1	0.642	0.241	2.611E-20	1074	0.228	0.083	Q96KR1.pdb.gz	ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2
5	AFDB:Q2TAV5	0.645	0.289	1.076E-18	902	0.218	0.094	Q2TAV5.pdb.gz	Q2TAV5_XENLA CBTF122 protein OS=Xenopus laevis OX=8355 GN=ilf3.S PE=2 SV=1
6	AFDB:Q91WM1	0.652	0.386	2.085E-18	672	0.200	0.116	Q91WM1.pdb.gz	STRBP_MOUSE Spermatid perinuclear RNA-binding protein OS=Mus musculus OX=10090 GN=Strbp PE=1 SV=1
7	AFDB:Q9Z1X4	0.648	0.291	2.194E-18	898	0.215	0.094	Q9Z1X4.pdb.gz	ILF3_MOUSE Interleukin enhancer-binding factor 3 OS=Mus musculus OX=10090 GN=Ilf3 PE=1 SV=2
8	AFDB:Q86BI3	0.646	0.296	2.430E-18	884	0.238	0.105	Q86BI3.pdb.gz	Q86BI3_DROME Zinc-finger protein at 72D, isoform B OS=Drosophila melanogaster OX=7227 GN=Zn72D PE=1 SV=1
9	AFDB:E9RKC7	0.630	0.331	2.662E-17	764	0.231	0.118	E9RKC7.pdb.gz	E9RKC7_CAEEL DZF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=zfr-1 PE=1 SV=1
10	AFDB:Q6DD04	0.628	0.287	9.903E-16	898	0.226	0.098	Q6DD04.pdb.gz	ILF3B_XENLA Interleukin enhancer-binding factor 3-B OS=Xenopus laevis OX=8355 GN=ilf3-b PE=1 SV=2
11	AFDB:P00973	0.431	0.422	7.131E-9	400	0.174	0.170	P00973.pdb.gz	OAS1_HUMAN 2'-5'-oligoadenylate synthase 1 OS=Homo sapiens OX=9606 GN=OAS1 PE=1 SV=4
12	PDB:4rwnA	0.410	0.452	1.595E-8	349	0.133	0.149	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
13	PDB:5wyjCB	0.447	0.178	8.141E-8	1098	0.121	0.043	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
14	PDB:4e7xD	0.444	0.528	8.388E-6	320	0.087	0.106	4e7xD.pdb.gz
15	PDB:7mq8NH	0.466	0.191	1.082E-5	1066	0.118	0.043	7mq8NH.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:3c66A	0.516	0.396	1.139E-5	529	0.126	0.093	3c66A.pdb.gz	Structure of yeast poly(A) polymerase in complex with a peptide from Fip1, an intrinsically disordered protein.
17	PDB:4xj6A	0.347	0.362	1.261E-5	370	0.113	0.119	4xj6A.pdb.gz	Structural Basis for the Catalytic Mechanism of DncV, Bacterial Homolog of Cyclic GMP-AMP Synthase
18	PDB:4txzB	0.367	0.386	1.546E-5	366	0.121	0.128	4txzB.pdb.gz	Structure-Guided Reprogramming of Human cGAS Dinucleotide Linkage Specificity.
19	PDB:4ud5B	0.376	0.423	1.994E-5	342	0.077	0.088	4ud5B.pdb.gz
20	PDB:4u03A	0.333	0.334	2.707E-5	389	0.118	0.118	4u03A.pdb.gz	Structural Biochemistry of a Vibrio cholerae Dinucleotide Cyclase Reveals Cyclase Activity Regulation by Folates.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DY09	0.0	717	352	0.903	1.000	B4DY09_HUMAN Interleukin enhancer binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=1
2	F4ZW62	0.0	801	390	1.000	1.000	F4ZW62_HUMAN NF45 OS=Homo sapiens OX=9606 PE=1 SV=1
3	K7GS49	0.0	797	390	0.995	0.995	K7GS49_PIG Interleukin enhancer-binding factor 2 OS=Sus scrofa OX=9823 GN=ILF2 PE=1 SV=1
4	Q12905	0.0	801	390	1.000	1.000	ILF2_HUMAN Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2
5	Q9CXY6	0.0	801	390	1.000	1.000	ILF2_MOUSE Interleukin enhancer-binding factor 2 OS=Mus musculus OX=10090 GN=Ilf2 PE=1 SV=1
6	Q9VG73	8.33e-150	431	396	0.572	0.563	ILF2_DROME Interleukin enhancer-binding factor 2 homolog OS=Drosophila melanogaster OX=7227 GN=CG5641 PE=2 SV=1
7	X6R6Z1	6.06e-75	230	115	0.295	1.000	X6R6Z1_HUMAN Interleukin enhancer binding factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=1
8	Q91550	1.35e-21	99.4	897	0.156	0.068	ILF3A_XENLA Interleukin enhancer-binding factor 3-A OS=Xenopus laevis OX=8355 GN=ilf3-a PE=1 SV=2
9	Q96SI9	2.06e-21	98.6	672	0.154	0.089	STRBP_HUMAN Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP PE=1 SV=1
10	Q2TAV5	2.08e-21	98.6	902	0.151	0.065	Q2TAV5_XENLA CBTF122 protein OS=Xenopus laevis OX=8355 GN=ilf3.S PE=2 SV=1
11	A0A0S2Z5K8	2.37e-21	98.2	657	0.154	0.091	A0A0S2Z5K8_HUMAN Spermatid perinuclear RNA-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=STRBP PE=1 SV=1
12	Q91WM1	5.72e-21	97.1	672	0.154	0.089	STRBP_MOUSE Spermatid perinuclear RNA-binding protein OS=Mus musculus OX=10090 GN=Strbp PE=1 SV=1
13	Q9Z1X4	7.35e-21	97.1	898	0.213	0.092	ILF3_MOUSE Interleukin enhancer-binding factor 3 OS=Mus musculus OX=10090 GN=Ilf3 PE=1 SV=2
14	Q9JIL3	7.98e-21	97.1	897	0.213	0.093	ILF3_RAT Interleukin enhancer-binding factor 3 OS=Rattus norvegicus OX=10116 GN=Ilf3 PE=1 SV=2
15	Q6DD04	1.74e-20	95.9	898	0.154	0.067	ILF3B_XENLA Interleukin enhancer-binding factor 3-B OS=Xenopus laevis OX=8355 GN=ilf3-b PE=1 SV=2
16	Q12906	2.42e-20	95.5	894	0.210	0.092	ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3
17	Q96KR1	3.07e-20	95.1	1074	0.177	0.064	ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2
18	Q562A2	7.17e-20	94.0	1073	0.177	0.064	ZFR_RAT Zinc finger RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Zfr PE=1 SV=2
19	E9RKC7	7.71e-17	84.7	764	0.195	0.099	E9RKC7_CAEEL DZF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=zfr-1 PE=1 SV=1
20	Q86BI3	2.65e-15	80.1	884	0.179	0.079	Q86BI3_DROME Zinc-finger protein at 72D, isoform B OS=Drosophila melanogaster OX=7227 GN=Zn72D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07528 DZF	4.6e-92	319.7	DZF domain
2	PF01909 NTP_transf_2	5.6e+02	12.3	Nucleotidyltransferase domain
3	PF18144 SMODS	11	17.6	Second Messenger Oligonucleotide or Dinucleotide Synthetase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006861533.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006875166.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 18 Proteins
2	185453.XP_006862382.1	0.953	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins
3	185453.XP_006834258.1	0.944	Small nuclear ribonucleoprotein Sm D2-like
4	185453.XP_006862199.1	0.944	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 Proteins
5	185453.XP_006867459.1	0.944	Small nuclear ribonucleoprotein Sm D2
6	185453.XP_006874594.1	0.944	Small nuclear ribonucleoprotein Sm D2-like
7	185453.XP_006874988.1	0.944	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 12 Proteins
8	185453.XP_006871510.1	0.937	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins
9	185453.XP_006832261.1	0.930	Heterogeneous nuclear ribonucleoproteins A2/B1 isoform X1
10	185453.XP_006875050.1	0.916	pre-mRNA-processing factor 19
11	185453.XP_006860446.1	0.904	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 14 Proteins
12	185453.XP_006866191.1	0.898	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 26 Proteins
13	185453.XP_006872619.1	0.892	ATP-dependent RNA helicase A-like
14	185453.XP_006868937.1	0.886	Heterogeneous nuclear ribonucleoprotein M isoform X1
15	185453.XP_006871588.1	0.885	rRNA 2'-O-methyltransferase fibrillarin
16	185453.XP_006835511.1	0.881	Protein arginine N-methyltransferase 5 isoform X1
17	185453.XP_006835023.1	0.880	Heterogeneous nuclear ribonucleoprotein K isoform X1
18	185453.XP_006870871.1	0.880	Heterogeneous nuclear ribonucleoprotein K-like
19	185453.XP_006869691.1	0.873	THO complex subunit 4
20	185453.XP_006868931.1	0.870	ELAV-like protein 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.924	heterocyclic compound binding
GO:0097159	0.924	organic cyclic compound binding
GO:0003676	0.906	nucleic acid binding
GO:0003723	0.696	RNA binding
GO:0003824	0.405	catalytic activity
GO:0003677	0.386	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0010468	0.990	regulation of gene expression
GO:0009893	0.985	positive regulation of metabolic process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0010556	0.984	regulation of macromolecule biosynthetic process
GO:0051173	0.984	positive regulation of nitrogen compound metabolic process
GO:0010604	0.984	positive regulation of macromolecule metabolic process
GO:0031326	0.983	regulation of cellular biosynthetic process
GO:0031325	0.983	positive regulation of cellular metabolic process
GO:0006355	0.955	regulation of DNA-templated transcription
GO:0045935	0.924	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.919	positive regulation of cellular biosynthetic process
GO:0051254	0.896	positive regulation of RNA metabolic process
GO:0010557	0.895	positive regulation of macromolecule biosynthetic process
GO:0009987	0.884	cellular process
GO:0071704	0.818	organic substance metabolic process
GO:1903508	0.817	positive regulation of nucleic acid-templated transcription
GO:0045893	0.813	positive regulation of DNA-templated transcription
GO:0044238	0.809	primary metabolic process
GO:0006807	0.777	nitrogen compound metabolic process
GO:0043170	0.734	macromolecule metabolic process
GO:0044237	0.697	cellular metabolic process
GO:0034641	0.630	cellular nitrogen compound metabolic process
GO:0006725	0.550	cellular aromatic compound metabolic process
GO:1901360	0.548	organic cyclic compound metabolic process
GO:0006139	0.538	nucleobase-containing compound metabolic process
GO:0010467	0.380	gene expression
GO:0090304	0.376	nucleic acid metabolic process
GO:0016070	0.359	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043228	0.928	non-membrane-bounded organelle
GO:0043232	0.915	intracellular non-membrane-bounded organelle
GO:0032991	0.818	protein-containing complex
GO:0005737	0.785	cytoplasm
GO:0005730	0.470	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]