StarFunc result for job id Q12906

User Input

>input (894 residues)
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQA
ESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKP
TTALLDKVADNLAIQLAAVTEDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEM
EKVLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRV
PTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEAT
DAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNENPVDYTVQIP
PSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKL
VSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKGE
DSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTKHGKNPVMELNEKRRGLK
YELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANK
KKRAPVPVRGGPKFAAKPHNPGFGMGGPMHNEVPPPPNLRGRGRGGSIRGRGRGRGFGGA
NHGGYMNAGAGYGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSYYQGD
NYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKGYNHG
QGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGS
GGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z1X4	0.458	0.456	0.000	898	0.934	0.930	Q9Z1X4.pdb.gz	ILF3_MOUSE Interleukin enhancer-binding factor 3 OS=Mus musculus OX=10090 GN=Ilf3 PE=1 SV=2
2	AFDB:Q2TAV5	0.452	0.449	1.575E-95	902	0.725	0.718	Q2TAV5.pdb.gz	Q2TAV5_XENLA CBTF122 protein OS=Xenopus laevis OX=8355 GN=ilf3.S PE=2 SV=1
3	AFDB:Q6DD04	0.429	0.427	1.237E-84	898	0.678	0.675	Q6DD04.pdb.gz	ILF3B_XENLA Interleukin enhancer-binding factor 3-B OS=Xenopus laevis OX=8355 GN=ilf3-b PE=1 SV=2
4	AFDB:Q96KR1	0.345	0.288	4.037E-32	1074	0.207	0.172	Q96KR1.pdb.gz	ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2
5	PDB:4atbA	0.292	0.750	1.849E-16	334	0.085	0.228	4atbA.pdb.gz	NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
6	PDB:7zpkC	0.101	0.291	2.760E-9	233	0.049	0.189	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
7	PDB:8dfvK	0.069	0.231	3.801E-7	253	0.041	0.146	8dfvK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
8	PDB:4rwnA	0.200	0.450	1.237E-6	349	0.049	0.126	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
9	PDB:4e7xD	0.225	0.567	1.370E-6	320	0.053	0.147	4e7xD.pdb.gz
10	PDB:4u03A	0.215	0.425	2.078E-5	389	0.063	0.144	4u03A.pdb.gz	Structural Biochemistry of a Vibrio cholerae Dinucleotide Cyclase Reveals Cyclase Activity Regulation by Folates.
11	PDB:7mq8NH	0.215	0.184	2.188E-5	1066	0.044	0.037	7mq8NH.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:4txzB	0.228	0.486	2.424E-5	366	0.060	0.148	4txzB.pdb.gz	Structure-Guided Reprogramming of Human cGAS Dinucleotide Linkage Specificity.
13	PDB:7v6cB	0.072	0.236	2.827E-5	260	0.035	0.119	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
14	AFDB:F4JFF2	0.224	0.160	4.068E-5	1303	0.143	0.098	F4JFF2.pdb.gz	F4JFF2_ARATH Nucleotidyltransferase OS=Arabidopsis thaliana OX=3702 GN=NTP8 PE=1 SV=1
15	PDB:5wyjCB	0.211	0.176	6.763E-5	1098	0.050	0.041	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
16	AFDB:Q9C0B9	0.052	0.042	2.032E-1	1178	0.138	0.104	Q9C0B9.pdb.gz	ZCHC2_HUMAN Zinc finger CCHC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZCCHC2 PE=1 SV=6
17	AFDB:Q8WYQ9	0.039	0.037	2.251E-1	949	0.113	0.106	Q8WYQ9.pdb.gz	ZCH14_HUMAN Zinc finger CCHC domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZCCHC14 PE=1 SV=1
18	AFDB:B0V0H4	0.071	0.063	4.166E-1	1071	0.148	0.123	B0V0H4.pdb.gz
19	AFDB:Q50360	0.045	0.063	4.166E-1	672	0.097	0.129	Q50360.pdb.gz	HMW3_MYCPN Cytadherence high molecular weight protein 3 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=hmw3 PE=1 SV=1
20	AFDB:Q9P1Y6	0.059	0.038	4.860E-1	1649	0.116	0.063	Q9P1Y6.pdb.gz	PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5K8	0.0	706	657	0.437	0.595	A0A0S2Z5K8_HUMAN Spermatid perinuclear RNA-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=STRBP PE=1 SV=1
2	K7EKJ9	0.0	529	254	0.284	1.000	K7EKJ9_HUMAN Interleukin enhancer binding factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=1
3	Q12906	0.0	1829	894	1.000	1.000	ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3
4	Q2TAV5	0.0	1030	902	0.711	0.705	Q2TAV5_XENLA CBTF122 protein OS=Xenopus laevis OX=8355 GN=ilf3.S PE=2 SV=1
5	Q6DD04	0.0	927	898	0.547	0.545	ILF3B_XENLA Interleukin enhancer-binding factor 3-B OS=Xenopus laevis OX=8355 GN=ilf3-b PE=1 SV=2
6	Q91550	0.0	973	897	0.655	0.653	ILF3A_XENLA Interleukin enhancer-binding factor 3-A OS=Xenopus laevis OX=8355 GN=ilf3-a PE=1 SV=2
7	Q91WM1	0.0	708	672	0.438	0.583	STRBP_MOUSE Spermatid perinuclear RNA-binding protein OS=Mus musculus OX=10090 GN=Strbp PE=1 SV=1
8	Q96SI9	0.0	711	672	0.443	0.589	STRBP_HUMAN Spermatid perinuclear RNA-binding protein OS=Homo sapiens OX=9606 GN=STRBP PE=1 SV=1
9	Q9JIL3	0.0	1301	897	0.911	0.907	ILF3_RAT Interleukin enhancer-binding factor 3 OS=Rattus norvegicus OX=10116 GN=Ilf3 PE=1 SV=2
10	Q9Z1X4	0.0	1300	898	0.802	0.798	ILF3_MOUSE Interleukin enhancer-binding factor 3 OS=Mus musculus OX=10090 GN=Ilf3 PE=1 SV=2
11	Q96KR1	8.79e-120	392	1074	0.208	0.173	ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2
12	Q562A2	1.01e-119	391	1073	0.208	0.173	ZFR_RAT Zinc finger RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Zfr PE=1 SV=2
13	K7ER69	6.04e-106	326	161	0.180	1.000	K7ER69_HUMAN Interleukin enhancer binding factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=1
14	Q86BI3	7.30e-92	312	884	0.185	0.187	Q86BI3_DROME Zinc-finger protein at 72D, isoform B OS=Drosophila melanogaster OX=7227 GN=Zn72D PE=1 SV=1
15	Q91ZS8	2.51e-41	164	711	0.122	0.153	RED1_MOUSE Double-stranded RNA-specific editase 1 OS=Mus musculus OX=10090 GN=Adarb1 PE=1 SV=1
16	P51400	2.63e-41	164	711	0.122	0.153	RED1_RAT Double-stranded RNA-specific editase 1 OS=Rattus norvegicus OX=10116 GN=Adarb1 PE=1 SV=1
17	P78563	5.17e-39	157	741	0.124	0.150	RED1_HUMAN Double-stranded RNA-specific editase 1 OS=Homo sapiens OX=9606 GN=ADARB1 PE=1 SV=1
18	E9RKC7	7.93e-39	157	764	0.125	0.147	E9RKC7_CAEEL DZF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=zfr-1 PE=1 SV=1
19	Q94540	4.12e-28	122	558	0.072	0.115	Q94540_DROME Zinc-finger protein Zn72D OS=Drosophila melanogaster OX=7227 GN=Zn72D PE=2 SV=1
20	F0JAG2	4.24e-28	123	631	0.072	0.101	F0JAG2_DROME MIP27703p OS=Drosophila melanogaster OX=7227 GN=Zn72D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14709 DND1_DSRM	5.5	18.7	double strand RNA binding domain from DEAD END PROTEIN 1
2	PF00035 dsrm	3.9e-21	86.9	Double-stranded RNA binding motif
3	PF07528 DZF	3e-105	362.9	DZF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404121

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221419	0.998	Heterogeneous nuclear ribonucleoprotein L
2	9606.ENSP00000355011	0.996	Interleukin enhancer-binding factor 2
3	9606.ENSP00000346694	0.994	Heterogeneous nuclear ribonucleoproteins A2/B1
4	9606.ENSP00000265351	0.987	Exportin-5
5	9606.ENSP00000451291	0.985	Heterogeneous nuclear ribonucleoproteins C1/C2
6	9606.ENSP00000356520	0.983	ATP-dependent RNA helicase A
7	9606.ENSP00000365439	0.982	Heterogeneous nuclear ribonucleoprotein K
8	9606.ENSP00000341826	0.978	Heterogeneous nuclear ribonucleoprotein A1
9	9606.ENSP00000385269	0.976	ELAV-like protein 1
10	9606.ENSP00000349428	0.971	Polypyrimidine tract-binding protein 1
11	9606.ENSP00000363745	0.971	Heterogeneous nuclear ribonucleoprotein R
12	9606.ENSP00000354346	0.969	Matrin-3
13	9606.ENSP00000349168	0.957	Heterogeneous nuclear ribonucleoprotein H
14	9606.ENSP00000276079	0.956	Non-POU domain-containing octamer-binding protein
15	9606.ENSP00000325376	0.945	Heterogeneous nuclear ribonucleoprotein M
16	9606.ENSP00000254108	0.935	RNA-binding protein FUS
17	9606.ENSP00000362820	0.929	Serine/arginine-rich splicing factor 3
18	9606.ENSP00000379475	0.925	Spliceosome RNA helicase DDX39B
19	9606.ENSP00000263209	0.920	Microprocessor complex subunit DGCR8
20	9606.ENSP00000451080	0.916	Enhancer of rudimentary homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003677	1.000	DNA binding
GO:0003725	0.983	double-stranded RNA binding
GO:0043565	0.416	sequence-specific DNA binding
GO:0003690	0.384	double-stranded DNA binding
GO:1990837	0.365	sequence-specific double-stranded DNA binding
GO:0000976	0.362	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0050794	0.986	regulation of cellular process
GO:1901564	0.980	organonitrogen compound metabolic process
GO:0043412	0.980	macromolecule modification
GO:0019222	0.975	regulation of metabolic process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0080090	0.945	regulation of primary metabolic process
GO:0051171	0.944	regulation of nitrogen compound metabolic process
GO:0048519	0.926	negative regulation of biological process
GO:0019538	0.916	protein metabolic process
GO:0031323	0.912	regulation of cellular metabolic process
GO:0010468	0.911	regulation of gene expression
GO:0031326	0.885	regulation of cellular biosynthetic process
GO:0010556	0.884	regulation of macromolecule biosynthetic process
GO:0009892	0.881	negative regulation of metabolic process
GO:0048523	0.872	negative regulation of cellular process
GO:0010605	0.865	negative regulation of macromolecule metabolic process
GO:0036211	0.846	protein modification process
GO:0031324	0.830	negative regulation of cellular metabolic process
GO:0051172	0.829	negative regulation of nitrogen compound metabolic process
GO:0006793	0.743	phosphorus metabolic process
GO:0009890	0.739	negative regulation of biosynthetic process
GO:0010558	0.734	negative regulation of macromolecule biosynthetic process
GO:0031327	0.733	negative regulation of cellular biosynthetic process
GO:0019219	0.637	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.632	regulation of RNA metabolic process
GO:0006468	0.631	protein phosphorylation
GO:0048518	0.538	positive regulation of biological process
GO:0044260	0.484	cellular macromolecule metabolic process
GO:0009893	0.449	positive regulation of metabolic process
GO:1903506	0.448	regulation of nucleic acid-templated transcription
GO:0006355	0.441	regulation of DNA-templated transcription
GO:0010604	0.435	positive regulation of macromolecule metabolic process
GO:0048522	0.431	positive regulation of cellular process
GO:0034641	0.336	cellular nitrogen compound metabolic process
GO:0051173	0.316	positive regulation of nitrogen compound metabolic process
GO:0051246	0.303	regulation of protein metabolic process
GO:0010467	0.300	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0032991	0.979	protein-containing complex
GO:0005730	0.796	nucleolus
GO:0005829	0.734	cytosol
GO:0005739	0.660	mitochondrion
GO:0016020	0.399	membrane
GO:1990904	0.389	ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]