StarFunc result for job id Q12913

User Input

>input (1337 residues)
MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQ
ISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPS
PVFDIKAVSISPTNVILTWKSNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPAT
SYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLL
ESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSR
AGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAI
EFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAV
IPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAE
SFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTVP
SAVFDIHVVYVTTTEMWLDWKSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGT
LYNITISPEVDHVWGDPNSTAQYTRPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLL
IEKAGNSSNATQVVTDIGITDATVTELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPA
SMASFDCEVVPKEPALVLKWTCPPGANAGFELEVSSGAWNNATHLESCSSENGTEYRTEV
TYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGF
EASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSE
VLKYEIDVGNESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRY
SDAVSLPQDPGVICGAVFGCIFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKL
IRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDIS
RVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTK
CVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHF
TSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIE
NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIY
ENLAPVTTFGKTNGYIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12913	1.000	1.000	0.000	1337	1.000	1.000	Q12913.pdb.gz	PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3
2	AFDB:Q62884	0.509	0.554	0.000	1216	0.664	0.730	Q62884.pdb.gz	Q62884_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 PE=1 SV=1
3	AFDB:Q64455	0.433	0.461	0.000	1238	0.669	0.722	Q64455.pdb.gz	PTPRJ_MOUSE Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2
4	AFDB:Q9HD43	0.247	0.290	3.468E-79	1115	0.233	0.280	Q9HD43.pdb.gz	PTPRH_HUMAN Receptor-type tyrosine-protein phosphatase H OS=Homo sapiens OX=9606 GN=PTPRH PE=1 SV=4
5	AFDB:P23467	0.227	0.153	4.891E-78	1997	0.245	0.164	P23467.pdb.gz	PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens OX=9606 GN=PTPRB PE=1 SV=3
6	AFDB:A0A0G2K2W0	0.238	0.157	9.795E-75	2238	0.248	0.148	A0A0G2K2W0.pdb.gz	A0A0G2K2W0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=2
7	AFDB:P70289	0.213	0.167	3.591E-74	1705	0.221	0.173	P70289.pdb.gz	PTPRV_MOUSE Receptor-type tyrosine-protein phosphatase V OS=Mus musculus OX=10090 GN=Ptprv PE=1 SV=1
8	AFDB:Q64612	0.216	0.169	9.466E-73	1711	0.218	0.171	Q64612.pdb.gz	PTPRV_RAT Receptor-type tyrosine-protein phosphatase V OS=Rattus norvegicus OX=10116 GN=Ptprv PE=1 SV=1
9	AFDB:P16621	0.210	0.140	9.598E-71	2029	0.196	0.129	P16621.pdb.gz	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
10	AFDB:E9Q0N2	0.233	0.300	1.480E-70	971	0.221	0.305	E9Q0N2.pdb.gz	PTPRH_MOUSE Receptor-type tyrosine-protein phosphatase H OS=Mus musculus OX=10090 GN=Ptprh PE=1 SV=1
11	PDB:4gwfA	0.205	0.541	1.773E-23	497	0.080	0.215	4gwfA.pdb.gz
12	PDB:3ps5A	0.210	0.517	8.269E-23	529	0.078	0.197	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	PDB:5xzrA	0.208	0.524	9.553E-23	519	0.079	0.204	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
14	PDB:6krwA	0.191	0.794	5.785E-19	306	0.065	0.284	6krwA.pdb.gz
15	PDB:7q1yA	0.113	0.111	1.940E-17	1374	0.066	0.064	7q1yA.pdb.gz
16	PDB:7q5zA	0.102	0.102	1.104E-15	1344	0.068	0.068	7q5zA.pdb.gz
17	PDB:5oj2B	0.101	0.166	2.064E-15	692	0.068	0.132	5oj2B.pdb.gz
18	PDB:5a42A	0.083	0.072	6.241E-15	1597	0.079	0.066	5a42A.pdb.gz
19	PDB:3m4uA	0.181	0.800	8.741E-15	285	0.062	0.291	3m4uA.pdb.gz
20	PDB:4lnvA	0.098	0.101	3.204E-14	1276	0.060	0.063	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B6HY54	0.0	584	1650	0.283	0.230	B6HY54_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=dep1a PE=2 SV=1
2	Q12913	0.0	2765	1337	1.000	1.000	PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3
3	Q62884	0.0	1713	1216	0.650	0.715	Q62884_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 PE=1 SV=1
4	Q64455	0.0	1722	1238	0.651	0.704	PTPRJ_MOUSE Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2
5	B2RU80	3.16e-126	434	1998	0.253	0.169	PTPRB_MOUSE Receptor-type tyrosine-protein phosphatase beta OS=Mus musculus OX=10090 GN=Ptprb PE=1 SV=1
6	A0A8I5ZV35	3.08e-124	428	2000	0.276	0.184	A0A8I5ZV35_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=3 SV=1
7	D3ZTG5	4.00e-124	428	2004	0.275	0.184	D3ZTG5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=3
8	A0A0G2K2W0	6.17e-124	428	2240	0.276	0.165	A0A0G2K2W0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=2
9	A0A8I5ZXS1	7.27e-124	428	2238	0.276	0.165	A0A8I5ZXS1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=3 SV=1
10	P23467	2.81e-121	419	1997	0.253	0.169	PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens OX=9606 GN=PTPRB PE=1 SV=3
11	A0A0R4ITJ9	1.19e-100	357	1892	0.232	0.164	A0A0R4ITJ9_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=R-PTP-beta PE=3 SV=2
12	P35992	1.00e-95	342	1990	0.215	0.145	PTP10_DROME Tyrosine-protein phosphatase 10D OS=Drosophila melanogaster OX=7227 GN=Ptp10D PE=1 SV=4
13	P70289	6.26e-93	333	1705	0.256	0.201	PTPRV_MOUSE Receptor-type tyrosine-protein phosphatase V OS=Mus musculus OX=10090 GN=Ptprv PE=1 SV=1
14	E9Q0N2	7.28e-90	315	971	0.111	0.153	PTPRH_MOUSE Receptor-type tyrosine-protein phosphatase H OS=Mus musculus OX=10090 GN=Ptprh PE=1 SV=1
15	Q9HD43	2.22e-88	314	1115	0.107	0.128	PTPRH_HUMAN Receptor-type tyrosine-protein phosphatase H OS=Homo sapiens OX=9606 GN=PTPRH PE=1 SV=4
16	X2JCK2	7.65e-88	318	1761	0.221	0.168	X2JCK2_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
17	E1JJE4	1.87e-87	316	1615	0.217	0.180	E1JJE4_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
18	Q8IRS0	2.09e-87	316	1607	0.217	0.180	Q8IRS0_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
19	Q9W4F5	2.83e-87	316	1767	0.217	0.164	Q9W4F5_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
20	Q24495	3.30e-86	312	1767	0.214	0.162	Q24495_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17425 Arylsulfotran_N	2	19.8	Arylsulfotransferase Ig-like domain
2	PF00782 DSPc	4.9	18.4	Dual specificity phosphatase, catalytic domain
3	PF00041 fn3	4.2e-39	144.1	Fibronectin type III domain
4	PF09294 Interfer-bind	1.4e+02	14.2	Interferon-alpha/beta receptor, fibronectin type III
5	PF10179 NDNF	1.5e+02	13.9	Neuron-derived neurotrophic factor, first Fn(III) domain
6	PF14566 PTPlike_phytase	13	17.3	Inositol hexakisphosphate
7	PF18861 PTP_tm	1.1e-30	118.0	TM proximal of protein tyrosine phosphatase, receptor type J
8	PF16656 Pur_ac_phosph_N	1.5e-08	46.5	Purple acid Phosphatase, N-terminal domain
9	PF00102 Y_phosphatase	1e-78	275.8	Protein-tyrosine phosphatase
10	PF13350 Y_phosphatase3	18	16.9	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400010

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317272	0.983	Hepatocyte growth factor receptor
2	9606.ENSP00000344115	0.983	Cadherin-5
3	9606.ENSP00000263923	0.977	Vascular endothelial growth factor receptor 2
4	9606.ENSP00000261799	0.973	Platelet-derived growth factor receptor beta
5	9606.ENSP00000344456	0.969	Catenin beta-1
6	9606.ENSP00000382004	0.963	Catenin delta-1
7	9606.ENSP00000337825	0.952	Tyrosine-protein kinase Lck
8	9606.ENSP00000362680	0.948	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000307046	0.947	Syndecan-2
10	9606.ENSP00000241453	0.937	Receptor-type tyrosine-protein kinase FLT3
11	9606.ENSP00000478570	0.928	Vascular endothelial growth factor A
12	9606.ENSP00000011653	0.921	T-cell surface glycoprotein CD4
13	9606.ENSP00000304669	0.917	Catenin alpha-1
14	9606.ENSP00000354782	0.916	T-cell surface glycoprotein CD3 zeta chain
15	9606.ENSP00000222390	0.907	Hepatocyte growth factor
16	9606.ENSP00000300692	0.905	T-cell surface glycoprotein CD3 delta chain
17	9606.ENSP00000431445	0.905	T-cell surface glycoprotein CD3 gamma chain
18	9606.ENSP00000354566	0.903	T-cell surface glycoprotein CD3 epsilon chain
19	9606.ENSP00000330382	0.902	Platelet-derived growth factor subunit B
20	9606.ENSP00000364080	0.901	HLA class II histocompatibility antigen, DQ beta 1 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008013	0.998	beta-catenin binding
GO:0005102	0.998	signaling receptor binding
GO:0004725	0.998	protein tyrosine phosphatase activity
GO:0045296	0.997	cadherin binding
GO:0051019	0.997	mitogen-activated protein kinase binding
GO:0070851	0.992	growth factor receptor binding
GO:0070097	0.580	delta-catenin binding
GO:0045295	0.553	gamma-catenin binding
GO:0005001	0.351	transmembrane receptor protein tyrosine phosphatase activity
GO:0044877	0.329	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0044237	0.969	cellular metabolic process
GO:0048583	0.965	regulation of response to stimulus
GO:0036211	0.965	protein modification process
GO:0051716	0.964	cellular response to stimulus
GO:0048518	0.962	positive regulation of biological process
GO:0006796	0.962	phosphate-containing compound metabolic process
GO:0048522	0.954	positive regulation of cellular process
GO:0060255	0.945	regulation of macromolecule metabolic process
GO:0043408	0.928	regulation of MAPK cascade
GO:0032501	0.918	multicellular organismal process
GO:0030155	0.914	regulation of cell adhesion
GO:0006470	0.909	protein dephosphorylation
GO:0048519	0.906	negative regulation of biological process
GO:0035335	0.898	peptidyl-tyrosine dephosphorylation
GO:0002684	0.893	positive regulation of immune system process
GO:0031323	0.892	regulation of cellular metabolic process
GO:0080090	0.887	regulation of primary metabolic process
GO:0071901	0.880	negative regulation of protein serine/threonine kinase activity
GO:0042221	0.872	response to chemical
GO:0040012	0.871	regulation of locomotion
GO:0007154	0.865	cell communication
GO:0023052	0.864	signaling
GO:0048584	0.864	positive regulation of response to stimulus
GO:1902532	0.859	negative regulation of intracellular signal transduction
GO:0043407	0.854	negative regulation of MAP kinase activity
GO:0050778	0.843	positive regulation of immune response
GO:0045785	0.842	positive regulation of cell adhesion
GO:0030334	0.816	regulation of cell migration
GO:0007165	0.801	signal transduction
GO:0070887	0.788	cellular response to chemical stimulus
GO:1902533	0.780	positive regulation of intracellular signal transduction
GO:0007166	0.766	cell surface receptor signaling pathway
GO:0040011	0.763	locomotion
GO:0032502	0.748	developmental process
GO:0009605	0.733	response to external stimulus
GO:0048856	0.731	anatomical structure development
GO:0009893	0.719	positive regulation of metabolic process
GO:0010033	0.712	response to organic substance
GO:0071310	0.704	cellular response to organic substance
GO:0042127	0.699	regulation of cell population proliferation
GO:0007167	0.697	enzyme-linked receptor protein signaling pathway
GO:0065008	0.693	regulation of biological quality
GO:0010810	0.673	regulation of cell-substrate adhesion
GO:0002376	0.669	immune system process
GO:0051128	0.668	regulation of cellular component organization
GO:0030336	0.664	negative regulation of cell migration
GO:0010811	0.653	positive regulation of cell-substrate adhesion
GO:0034097	0.597	response to cytokine
GO:0051239	0.588	regulation of multicellular organismal process
GO:0010604	0.562	positive regulation of macromolecule metabolic process
GO:0051247	0.539	positive regulation of protein metabolic process
GO:0031325	0.529	positive regulation of cellular metabolic process
GO:0050854	0.493	regulation of antigen receptor-mediated signaling pathway
GO:0007275	0.483	multicellular organism development
GO:0010468	0.457	regulation of gene expression
GO:1901184	0.392	regulation of ERBB signaling pathway
GO:0051240	0.381	positive regulation of multicellular organismal process
GO:0048731	0.380	system development
GO:0042330	0.330	taxis
GO:0042327	0.320	positive regulation of phosphorylation
GO:0040017	0.315	positive regulation of locomotion
GO:2000147	0.312	positive regulation of cell motility
GO:0006950	0.301	response to stress
GO:0044093	0.300	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.992	endomembrane system
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005576	0.967	extracellular region
GO:0005737	0.964	cytoplasm
GO:0070062	0.914	extracellular exosome
GO:0097708	0.902	intracellular vesicle
GO:0031090	0.898	organelle membrane
GO:0031410	0.883	cytoplasmic vesicle
GO:0009986	0.863	cell surface
GO:0098588	0.767	bounding membrane of organelle
GO:0012506	0.722	vesicle membrane
GO:0030659	0.713	cytoplasmic vesicle membrane
GO:0030054	0.707	cell junction
GO:0070161	0.703	anchoring junction
GO:0099503	0.619	secretory vesicle
GO:0001772	0.494	immunological synapse
GO:0030141	0.347	secretory granule
GO:0098590	0.305	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	0.998	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.998	protein-tyrosine-phosphatase.

[back to server]