StarFunc result for job id Q12918

User Input

>input (225 residues)
MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSV
SVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLA
DCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEI
RGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12918	1.000	1.000	1.694E-41	225	1.000	1.000	Q12918.pdb.gz	KLRB1_HUMAN Killer cell lectin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=KLRB1 PE=1 SV=1
2	AFDB:Q0ZUP1	0.551	0.579	3.740E-24	214	0.471	0.495	Q0ZUP1.pdb.gz	KLRB1_MOUSE Killer cell lectin-like receptor subfamily B member 1 OS=Mus musculus OX=10090 GN=Klrb1 PE=2 SV=1
3	AFDB:P27812	0.582	0.587	1.707E-22	223	0.467	0.471	P27812.pdb.gz	KRBBA_MOUSE Killer cell lectin-like receptor subfamily B member 1B allele A OS=Mus musculus OX=10090 GN=Klrb1b PE=1 SV=1
4	AFDB:Q8VD98	0.562	0.582	5.856E-22	217	0.440	0.456	Q8VD98.pdb.gz	KLRBF_MOUSE Killer cell lectin-like receptor subfamily B member 1F OS=Mus musculus OX=10090 GN=Klrb1f PE=2 SV=1
5	AFDB:P27811	0.553	0.548	1.357E-20	227	0.462	0.458	P27811.pdb.gz	KLRBA_MOUSE Killer cell lectin-like receptor subfamily B member 1A OS=Mus musculus OX=10090 GN=Klrb1a PE=1 SV=2
6	AFDB:P27814	0.581	0.586	4.655E-20	223	0.467	0.471	P27814.pdb.gz	KLRBC_MOUSE Killer cell lectin-like receptor subfamily B member 1C OS=Mus musculus OX=10090 GN=Klrb1c PE=1 SV=2
7	AFDB:D3W0D1	0.533	0.578	1.652E-15	207	0.222	0.242	D3W0D1.pdb.gz	KLRF2_HUMAN Killer cell lectin-like receptor subfamily F member 2 OS=Homo sapiens OX=9606 GN=KLRF2 PE=1 SV=1
8	AFDB:Q96E93	0.503	0.577	1.719E-14	195	0.218	0.251	Q96E93.pdb.gz	KLRG1_HUMAN Killer cell lectin-like receptor subfamily G member 1 OS=Homo sapiens OX=9606 GN=KLRG1 PE=1 SV=1
9	AFDB:Q9TTK7	0.523	0.432	2.068E-14	274	0.236	0.193	Q9TTK7.pdb.gz	OLR1_PIG Oxidized low-density lipoprotein receptor 1 OS=Sus scrofa OX=9823 GN=OLR1 PE=2 SV=1
10	AFDB:P37217	0.496	0.559	5.895E-14	199	0.187	0.211	P37217.pdb.gz	CD69_MOUSE Early activation antigen CD69 OS=Mus musculus OX=10090 GN=Cd69 PE=2 SV=1
11	PDB:7wz8A	0.468	0.576	1.470E-9	180	0.169	0.211	7wz8A.pdb.gz
12	PDB:1qddA	0.486	0.731	7.760E-9	144	0.116	0.181	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
13	PDB:7qsrA	0.445	0.081	8.585E-8	1335	0.120	0.020	7qsrA.pdb.gz
14	PDB:1htnA	0.462	0.649	2.603E-7	156	0.129	0.186	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
15	PDB:5f2qB	0.419	0.661	2.603E-7	135	0.102	0.170	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
16	PDB:1bj3B	0.402	0.704	2.945E-7	123	0.124	0.228	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
17	PDB:7jptA	0.449	0.085	4.821E-7	1327	0.129	0.022	7jptA.pdb.gz
18	PDB:4mthA	0.458	0.711	5.128E-7	139	0.098	0.158	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
19	PDB:3bx4C	0.396	0.640	6.169E-7	134	0.116	0.194	3bx4C.pdb.gz
20	PDB:2kv3A	0.426	0.690	7.894E-7	131	0.107	0.183	2kv3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12918	8.33e-166	457	225	1.000	1.000	KLRB1_HUMAN Killer cell lectin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=KLRB1 PE=1 SV=1
2	Q0ZUP1	6.51e-67	207	214	0.476	0.500	KLRB1_MOUSE Killer cell lectin-like receptor subfamily B member 1 OS=Mus musculus OX=10090 GN=Klrb1 PE=2 SV=1
3	P27811	4.60e-63	197	227	0.462	0.458	KLRBA_MOUSE Killer cell lectin-like receptor subfamily B member 1A OS=Mus musculus OX=10090 GN=Klrb1a PE=1 SV=2
4	P27812	4.59e-62	195	223	0.458	0.462	KRBBA_MOUSE Killer cell lectin-like receptor subfamily B member 1B allele A OS=Mus musculus OX=10090 GN=Klrb1b PE=1 SV=1
5	Q99JB4	8.61e-60	189	223	0.440	0.444	KRBBB_MOUSE Killer cell lectin-like receptor subfamily B member 1B allele B OS=Mus musculus OX=10090 GN=Klrb1b PE=1 SV=1
6	P27814	1.19e-59	189	223	0.458	0.462	KLRBC_MOUSE Killer cell lectin-like receptor subfamily B member 1C OS=Mus musculus OX=10090 GN=Klrb1c PE=1 SV=2
7	Q8VD98	6.06e-52	169	217	0.444	0.461	KLRBF_MOUSE Killer cell lectin-like receptor subfamily B member 1F OS=Mus musculus OX=10090 GN=Klrb1f PE=2 SV=1
8	Q9NZS2	1.95e-22	93.2	231	0.200	0.195	KLRF1_HUMAN Killer cell lectin-like receptor subfamily F member 1 OS=Homo sapiens OX=9606 GN=KLRF1 PE=1 SV=3
9	D3W0D1	7.66e-17	77.8	207	0.227	0.246	KLRF2_HUMAN Killer cell lectin-like receptor subfamily F member 2 OS=Homo sapiens OX=9606 GN=KLRF2 PE=1 SV=1
10	Q9R007	1.15e-14	71.6	190	0.236	0.279	CLC5A_MOUSE C-type lectin domain family 5 member A OS=Mus musculus OX=10090 GN=Clec5a PE=1 SV=2
11	Q14DL9	2.42e-12	64.7	165	0.209	0.285	Q14DL9_HUMAN C-type lectin domain containing 5A OS=Homo sapiens OX=9606 GN=CLEC5A PE=1 SV=1
12	Q6QLQ4	2.74e-12	66.2	244	0.204	0.189	CLC7A_MOUSE C-type lectin domain family 7 member A OS=Mus musculus OX=10090 GN=Clec7a PE=1 SV=3
13	Q9BXN2	1.81e-11	63.9	247	0.249	0.227	CLC7A_HUMAN C-type lectin domain family 7 member A OS=Homo sapiens OX=9606 GN=CLEC7A PE=1 SV=1
14	Q2HXU8	2.36e-11	63.9	276	0.187	0.152	CL12B_HUMAN C-type lectin domain family 12 member B OS=Homo sapiens OX=9606 GN=CLEC12B PE=1 SV=1
15	Q91V08	1.12e-10	61.2	207	0.253	0.275	CLC2D_MOUSE C-type lectin domain family 2 member D OS=Mus musculus OX=10090 GN=Clec2d PE=1 SV=1
16	O70215	1.28e-10	61.2	215	0.222	0.233	NKG2D_RAT NKG2-D type II integral membrane protein OS=Rattus norvegicus OX=10116 GN=Klrk1 PE=2 SV=1
17	A0A0G2JYI2	1.82e-10	59.7	158	0.196	0.278	A0A0G2JYI2_RAT Cd69 molecule OS=Rattus norvegicus OX=10116 GN=Cd69 PE=4 SV=1
18	A4D1U7	1.95e-10	60.1	188	0.209	0.250	A4D1U7_HUMAN C-type (Calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5 OS=Homo sapiens OX=9606 GN=CLECSF5 PE=2 SV=1
19	Q9NY25	1.95e-10	60.1	188	0.209	0.250	CLC5A_HUMAN C-type lectin domain family 5 member A OS=Homo sapiens OX=9606 GN=CLEC5A PE=1 SV=1
20	Q96E93	2.35e-10	60.1	195	0.156	0.179	KLRG1_HUMAN Killer cell lectin-like receptor subfamily G member 1 OS=Homo sapiens OX=9606 GN=KLRG1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00059 Lectin_C	3.3e-11	55.2	Lectin C-type domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261340	0.998	C-type lectin domain family 2 member D
2	9606.ENSP00000340409	0.917	Sphingomyelin phosphodiesterase
3	9606.ENSP00000274306	0.875	Granzyme A
4	9606.ENSP00000337825	0.868	Tyrosine-protein kinase Lck
5	9606.ENSP00000240618	0.863	Killer cell lectin-like receptor subfamily K, member 1
6	9606.ENSP00000358490	0.857	T-cell surface antigen CD2
7	9606.ENSP00000231009	0.815	Granzyme K
8	9606.ENSP00000216341	0.807	Granzyme B
9	9606.ENSP00000386559	0.798	T-cell surface glycoprotein CD8 alpha chain
10	9606.ENSP00000396163	0.788	C-type lectin domain family 2 member A
11	9606.ENSP00000383715	0.763	C-C chemokine receptor type 6
12	9606.ENSP00000343952	0.754	Chemokine (C-C motif) receptor 6
13	9606.ENSP00000011653	0.753	T-cell surface glycoprotein CD4
14	9606.ENSP00000362181	0.745	Natural cytotoxicity triggering receptor 2
15	9606.ENSP00000349967	0.730	C-C chemokine receptor-like 2
16	9606.ENSP00000228434	0.726	Early activation antigen CD69
17	9606.ENSP00000398568	0.723	Perforin-1
18	9606.ENSP00000480132	0.715	Neural cell adhesion molecule 1
19	9606.ENSP00000356946	0.712	Low affinity immunoglobulin gamma Fc region receptor III-A
20	9606.ENSP00000291890	0.708	Natural cytotoxicity triggering receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0030246	0.995	carbohydrate binding
GO:0004888	0.953	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.997	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0007165	0.983	signal transduction
GO:0007166	0.944	cell surface receptor signaling pathway
GO:0048518	0.732	positive regulation of biological process
GO:0002376	0.706	immune system process
GO:0048522	0.521	positive regulation of cellular process
GO:0048583	0.477	regulation of response to stimulus
GO:0032501	0.425	multicellular organismal process
GO:0002684	0.349	positive regulation of immune system process
GO:0048584	0.324	positive regulation of response to stimulus
GO:0048519	0.316	negative regulation of biological process
GO:0048523	0.301	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.636	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]